Property Summary

NCBI Gene PubMed Count 27
Grant Count 28
R01 Count 22
Funding $1,380,709.1
PubMed Score 39.72
PubTator Score 37.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26745464 In addition to Atox1, the human cytoplasm also contains Cu chaperones for loading of superoxide dismutase 1 (i.e. CCS) and cytochrome c oxidase in mitochondria (i.e. Cox17). [review]
26589182 Data show that the redox state of cytochrome c oxidase assembly protein 17 (Cox17), mitochondrial membrane transport protein Mia40 and superoxide dismutase 1 (SOD1) in the cytoplasm were directly observed with in-cell NMR spectroscopy.
26399480 Data suggest that Cox17 enhances the reactivity of some platinum/organoplatinum antineoplastic drugs but suppresses the reactivity of at least one platinum antineoplastic drug; glutathione modulates binding of platinum/organoplatinum drugs to Cox17.
24343031 CTR1 silencing increased the protein levels of copper chaperone ATOX1 and copper chaperone for superoxide dismutase 1 (CCS-1), but decreased copper chaperone for cytochrome c oxidase (COX17).
21816817 Functional role of two interhelical disulfide bonds in human Cox17 protein from a structural perspective.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19393246 the absence of Cox17 interferes with copper delivery to Cox2, but not to Cox1.
18458339 Cu(I)HCox17(2S-S), i.e., the copper-loaded form of the protein, can transfer simultaneously copper(I) and two electrons to the human cochaperone Sco1 (HSco1) in the oxidized state, i.e., with its metal-binding cysteines forming a disulfide bond.
17672825 XAS (X-ray absorption spectroscopy) determined that Cu4Cox17 contains a Cu4S6-type copper-thiolate cluster, which may provide safe storage of an excess of copper ions
17208454 Cox17 was studied with regard to its expression, purification, and formation of mixed disulfide adducts with sulfhydryl reagents.
More...

AA Sequence

MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI             1 - 63
//

Text Mined References (34)

PMID Year Title
26745464 2016 Extended functional repertoire for human copper chaperones.
26589182 2016 Direct structural evidence of protein redox regulation obtained by in-cell NMR.
26399480 2015 Glutathione selectively modulates the binding of platinum drugs to human copper chaperone Cox17.
25416956 2014 A proteome-scale map of the human interactome network.
24343031 2014 Changes in copper concentrations affect the protein levels but not the mRNA levels of copper chaperones in human umbilical vein endothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21816817 2011 Functional role of two interhelical disulfide bonds in human Cox17 protein from a structural perspective.
More...