Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.63
PubTator Score 37.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (14)

AA Sequence

MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI             1 - 63
//

Text Mined References (36)

PMID Year Title