Property Summary

NCBI Gene PubMed Count 49
PubMed Score 38.72
PubTator Score 61.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 2.500 3.4e-05
atypical teratoid / rhabdoid tumor 2.100 1.3e-03
Chronic Lymphocytic Leukemia 1.070 5.1e-04
ependymoma 1.400 8.9e-03
glioblastoma 1.300 4.1e-02
interstitial cystitis -1.400 7.2e-05
lung cancer 2.000 8.5e-04
ovarian cancer 1.300 1.3e-06
Pick disease -1.100 1.7e-03
pituitary cancer -2.800 1.3e-07
primitive neuroectodermal tumor 1.200 4.4e-02

Protein-protein Interaction (2)

Gene RIF (35)

AA Sequence

MAAATASPRSLLVLLQVVVLALAQIRGPPGERGPPGPPGPPGVPGSDGIDGDNGPPGKAGPPGPKGEPGK      1 - 70
AGPDGPDGKPGIDGLTGAKGEPGPMGIPGVKGQPGLPGPPGLPGPGFAGPPGPPGPVGLPGEIGIRGPKG     71 - 140
DPGPDGPSGPPGPPGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGVKGHAGKRGILGDPGHQGKP    141 - 210
GPKGDVGASGEQGIPGPPGPQGIRGYPGMAGPKGETGPHGYKGMVGAIGATGPPGEEGPRGPPGRAGEKG    211 - 280
DEGSPGIRGPQGITGPKGATGPPGINGKDGTPGTPGMKGSAGQAGQPGSPGHQGLAGVPGQPGTKGGPGD    281 - 350
QGEPGPQGLPGFSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQGPKGEQGPPGIPGPQ    351 - 420
GLPGVKGDKGSPGKTGPRGKVGDPGVAGLPGEKGEKGESGEPGPKGQQGVRGEPGYPGPSGDAGAPGVQG    421 - 490
YPGPPGPRGLAGNRGVPGQPGRQGVEGRDATDQHIVDVALKMLQEQLAEVAVSAKREALGAVGMMGPPGP    491 - 560
PGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKRGEKGDPGEVGRGHPGMPGPPGIPGLPGRPG    561 - 630
QAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP               631 - 689
//

Text Mined References (49)

PMID Year Title