Property Summary

NCBI Gene PubMed Count 52
PubMed Score 27.40
PubTator Score 31.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.400 7.2e-04
Astrocytoma, Pilocytic 1.200 1.6e-03
atypical teratoid / rhabdoid tumor 2.400 2.9e-05
Breast cancer -2.000 1.6e-04
colon cancer -1.500 1.7e-02
cystic fibrosis and chronic rhinosinusit... 1.032 4.1e-02
ependymoma 2.100 2.2e-03
fibroadenoma 1.600 9.9e-03
glioblastoma 1.100 4.8e-03
interstitial cystitis -1.300 1.4e-03
intraductal papillary-mucinous carcinoma... -1.100 3.1e-02
intraductal papillary-mucinous neoplasm ... -1.500 1.3e-02
lung cancer 1.500 1.9e-04
malignant mesothelioma -3.300 9.7e-09
medulloblastoma 1.200 8.6e-03
medulloblastoma, large-cell 2.000 3.4e-04
non-small cell lung cancer 1.523 1.3e-05
ovarian cancer -2.500 3.7e-14
pituitary cancer -2.500 2.7e-05
primitive neuroectodermal tumor 1.300 3.0e-02

 OMIM Phenotype (1)

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MLINKLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGST      1 - 70
GLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDG     71 - 140
YPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPP    141 - 210
GPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPG    211 - 280
LGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFI    281 - 350
DIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI    351 - 420
GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPN    421 - 490
TGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDR    491 - 560
GDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPR    561 - 630
GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPG    631 - 700
SPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLT    701 - 770
GHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISG    771 - 840
HPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGI    841 - 910
PGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSN    911 - 980
GFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQ    981 - 1050
GIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS   1051 - 1120
GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPG   1121 - 1190
PSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGD   1191 - 1260
PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEP   1261 - 1330
GFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQ   1331 - 1400
GPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTL   1401 - 1470
VKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRND   1471 - 1540
KSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAG   1541 - 1610
AEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTR   1611 - 1680
VSRCQVCMKSL                                                              1681 - 1691
//

Text Mined References (54)

PMID Year Title