Property Summary

NCBI Gene PubMed Count 29
Grant Count 102
R01 Count 40
Funding $13,676,676.96
PubMed Score 17.27
PubTator Score 65.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14019 B2RDU3 D3DUL9 Q86XM5
Symbols CLP

Gene

PDB

1T2L   1T3X   1T3Y   1TMW   1VFQ   1WNJ  

Gene RIF (14)

PMID Text
25034252 The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied.
24454796 COTL1 regulates lamellipodia dynamics in part by protecting F-actin from cofilin-mediated disassembly.
22373659 PAI-RBP1 and C1orf142 expression levels are higher in 95D (high metastatic potential) than in 95C (low metastatic potential) non-small lung cancer cells, whereas COTL1 expression level is lower in 95D when compared to 95C cells.
21047053 Up-regulated COTL-1 expression in small cell lung cancer was validated by Western blot analysis, immunohistochemistry, and qRT-qPCR.
19807693 Results of the present study support a role for CLP as a chaperoning scaffold factor, influencing both the stability and the activity of 5-LO.
19307756 We found that coactosin-like1 (COTL1) were highly expressed in rheumatoid arthritis patients compared with healthy controls
19307756 Observational study of gene-disease association. (HuGE Navigator)
17070122 extended region of beta4-beta5 of hCLP (residue 66-75) was found very flexible and very important for F-actin binding. The C-terminal residues of human coactosin-like protein were not involved in F-actin binding
16924104 Coactosin-like protein (CLP) up-regulates Ca(2+)-induced 5-lipoxygenase (5LO) activity, and increases the amount of Leukotriene A(4) formed by 5LO.
15583396 preliminary crystallographic studies of human coactosin-like protein (CLP)
More...

AA Sequence

MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM      1 - 70
SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ     71 - 140
TE                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25034252 2014 Roles of coactosin-like protein (CLP) and 5-lipoxygenase-activating protein (FLAP) in cellular leukotriene biosynthesis.
24454796 2014 Coactosin-like 1 antagonizes cofilin to promote lamellipodial protrusion at the immune synapse.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22373659 2012 Differential expression of PAI-RBP1, C1orf142, and COTL1 in non-small cell lung cancer cell lines with different tumor metastatic potential.
21269460 2011 Initial characterization of the human central proteome.
21047053 2011 Proteomic analysis of human small cell lung cancer tissues: up-regulation of coactosin-like protein-1.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
More...