Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.32
PubTator Score 65.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
adult high grade glioma 1.500 6.8e-04
astrocytoma 2.300 7.2e-03
Astrocytoma, Pilocytic 1.600 8.2e-08
Atopic dermatitis 1.200 9.2e-03
atypical teratoid / rhabdoid tumor 2.000 1.8e-06
Barrett's esophagus 2.100 1.5e-02
Becker muscular dystrophy 1.125 4.1e-04
Breast cancer 1.500 3.2e-03
cutaneous lupus erythematosus 1.700 4.1e-03
Duchenne muscular dystrophy 1.291 2.0e-10
ependymoma 1.200 2.6e-05
esophageal adenocarcinoma 2.300 1.8e-02
glioblastoma 1.100 1.2e-04
interstitial cystitis 2.000 6.9e-04
intraductal papillary-mucinous neoplasm ... 1.900 2.6e-02
juvenile dermatomyositis 1.447 7.5e-06
limb girdle muscular dystrophy 2I 1.050 1.5e-03
lung cancer -2.100 6.7e-05
medulloblastoma, large-cell 2.100 6.1e-04
non-small cell lung cancer -1.178 1.6e-11
osteosarcoma -1.824 4.9e-07
ovarian cancer -2.500 1.7e-07
pancreatic cancer 1.200 1.5e-03
pituitary cancer -1.100 3.1e-03
primary pancreatic ductal adenocarcinoma 2.353 4.7e-05
primary Sjogren syndrome 2.600 2.1e-04
primitive neuroectodermal tumor 1.400 1.9e-02
psoriasis 1.300 2.9e-09
spina bifida 1.347 5.0e-02
subependymal giant cell astrocytoma 1.339 1.1e-02
tuberculosis 1.200 1.8e-02
ulcerative colitis 1.300 2.8e-05

 IMPC Phenotype (1)

Gene RIF (14)

AA Sequence

MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM      1 - 70
SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ     71 - 140
TE                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title