Property Summary

Ligand Count 1
NCBI Gene PubMed Count 46
PubMed Score 39.49
PubTator Score 56.29

Knowledge Summary

Patent (5,823)

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.901 1.7e-03
adult high grade glioma -1.600 3.0e-04
astrocytic glioma -1.200 4.4e-03
atypical teratoid / rhabdoid tumor -1.400 1.4e-04
ductal carcinoma in situ -1.300 4.9e-04
ependymoma -1.500 1.2e-02
group 3 medulloblastoma -1.200 1.4e-02
invasive ductal carcinoma -1.500 2.2e-03
medulloblastoma, large-cell -2.200 2.4e-04
primitive neuroectodermal tumor -1.300 2.9e-02
Rheumatoid arthritis -1.300 2.8e-02
tuberculosis 1.900 8.3e-09

Gene RIF (21)

AA Sequence

MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL      1 - 70
HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR     71 - 140
DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI    141 - 210
LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT    211 - 280
ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC    281 - 350
CRDCCVEPGTELSPTLPHQL                                                      351 - 370
//

Text Mined References (55)

PMID Year Title