Property Summary

NCBI Gene PubMed Count 45
Grant Count 56
R01 Count 47
Funding $4,038,169.29
PubMed Score 42.67
PubTator Score 56.29

Knowledge Summary

Patent (5,823)

Expression

  Differential Expression (12)

Synonym

Accession Q14012 Q3KPF6
Symbols CAMKI

Gene

PDB

4FG7   4FG8   4FG9   4FGB  

 GO Component (2)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (20)

PMID Text
26466644 Barettin has inhibitory activity against two protein kinases related to inflammation, namely the receptor-interacting serine/threonine kinase 2 (RIPK2) and calcium/calmodulin-dependent protein kinase 1alpha (CAMK1alpha).
24841198 this study suggests that the tightly linked regulatory loop comprised of the SIK2-PP2A and CaMKI and PME-1 networks may function in fine-tuning cell proliferation and stress response.
24825433 CAMK1 functional regulation subnetwork in hepatocellular carcinoma
24461366 It is one of Ca(2+)-sensing proteins and substantial age- and Alzheimer disease(AD)-related alterations in Ca(2+)-sensing proteins most likely contribute to selective vulnerability of basal forebrain cholinergic neurons to degeneration in AD.
23707388 Fbxl12-induced CaMKI degradation attenuates p27 phosphorylation at these sites in early G1 and iii) activation of CaMKI during G1 transition followed by p27 phosphorylation appears to be upstream to other p27 phosphorylation events
23028635 structures of three CaMKIalpha truncates in apo form and in complexes with ATP
21249615 CaMKI was significantly upregulated in adrenal adenomas.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20433920 HIV-1 gp120-induced neuron death is inhibited by CCL3L1 treatment via the phosphorylation of CREB, the upregulation of Bcl-2, and the PKA and CaMKI/CaMKIV cell signaling pathways
More...

AA Sequence

MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL      1 - 70
HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR     71 - 140
DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI    141 - 210
LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT    211 - 280
ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC    281 - 350
CRDCCVEPGTELSPTLPHQL                                                      351 - 370
//

Text Mined References (54)

PMID Year Title
26466644 2015 The immunomodulatory effects of barettin and involvement of the kinases CAMK1? and RIPK2.
24841198 2014 Interaction between salt-inducible kinase 2 and protein phosphatase 2A regulates the activity of calcium/calmodulin-dependent protein kinase I and protein phosphatase methylesterase-1.
24825433 2014 CAMK1 phosphoinositide signal-mediated protein sorting and transport network in human hepatocellular carcinoma (HCC) by biocomputation.
24461366 2014 Alterations of Ca²?-responsive proteins within cholinergic neurons in aging and Alzheimer's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23707388 2013 Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I.
23028635 2012 Crystal structures of human CaMKI? reveal insights into the regulation mechanism of CaMKI.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21301225 2011 Controlling the cell cycle: the role of calcium/calmodulin-stimulated protein kinases I and II.
More...