Property Summary

NCBI Gene PubMed Count 46
PubMed Score 144.33
PubTator Score 33.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Alzheimer's disease -1.700 4.2e-02
astrocytic glioma 1.700 1.3e-02
Breast cancer -1.300 1.6e-10
dermatomyositis 1.600 2.0e-04
ependymoma 2.600 1.3e-02
group 4 medulloblastoma 1.100 3.6e-04
hepatocellular carcinoma 1.100 2.7e-04
interstitial lung disease 1.600 8.1e-03
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
intraductal papillary-mucinous carcinoma... -1.300 5.1e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.2e-03
invasive ductal carcinoma -1.154 5.1e-06
lung adenocarcinoma -1.600 8.0e-13
Multiple myeloma 2.016 1.3e-04
non-small cell lung cancer -1.061 5.0e-09
oligodendroglioma 1.800 1.7e-03
osteosarcoma -2.026 4.9e-04
ovarian cancer -2.600 4.5e-08
pancreatic cancer -1.400 1.1e-02
Pick disease -2.700 1.0e-07
primary pancreatic ductal adenocarcinoma -1.603 2.6e-03
progressive supranuclear palsy -2.400 7.0e-03
psoriasis -1.400 8.6e-04
subependymal giant cell astrocytoma -1.273 4.4e-02
tuberculosis -1.100 3.6e-03

Gene RIF (26)

AA Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK      1 - 70
SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD     71 - 140
YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE                                          141 - 172
//

Text Mined References (51)

PMID Year Title