Property Summary

NCBI Gene PubMed Count 34
Grant Count 31
R01 Count 23
Funding $6,565,612.15
PubMed Score 133.00
PubTator Score 33.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26673712 CIRP protein regulates telomerase activity in a temperature-dependent manner by regulating the level of TERT mRNAs.
26361390 Study shows that CIRP elevated plasma concentration is significantly associated with poor prognosis among patients with sepsis. Therefore, CIRP is a potential predictor of sepsis prognosis.
26188505 CIRP inhibits DNA damage-induced apoptosis by regulating p53 protein.CIRP suppresses p53 upregulation during apoptosis.CIRP regulates the expression of genes involved in apoptosis.
25934796 The expression of CIRP in pituitary adenoma is closely related with tumor proliferation and invasion, and its significantly elevated expression level indicates post-op recurrence.
25187386 Cirp promotes the development of intestinal inflammation and colorectal tumors through regulating apoptosis and production of TNFalpha and IL23 in inflammatory cells.
25027624 High levels of CIRP protein expression was associated with a short survival rate in oral squamous cell carcinoma patients.
24097189 report increased levels of cold-inducible RNA-binding protein (CIRP) in the blood of individuals admitted to the surgical intensive care unit with hemorrhagic shock
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cold inducible RNA binding protein (CIRBP) expression by HIV-1 Vpr in Vpr transduced macrophages
23437386 CIRBP regulates the expression of interleukin-1beta in an NF-kappaB-dependent fashion.
23437386 CIRBP contributes to ultraviolet light- and lipopolysaccharide-induced expression of IL1beta by regulating NFkappaB activity.
More...

AA Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK      1 - 70
SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD     71 - 140
YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE                                          141 - 172
//

Text Mined References (39)

PMID Year Title
26673712 2016 Cold-inducible RNA-binding protein CIRP/hnRNP A18 regulates telomerase activity in a temperature-dependent manner.
26361390 2015 The Cold-Inducible RNA-Binding Protein (CIRP) Level in Peripheral Blood Predicts Sepsis Outcome.
26188505 2015 Cold-inducible RNA-binding protein, CIRP, inhibits DNA damage-induced apoptosis by regulating p53.
25934796 2015 Expression of cold-inducible RNA-binding protein (CIRP) in pituitary adenoma and its relationships with tumor recurrence.
25416956 2014 A proteome-scale map of the human interactome network.
25187386 2014 Stress response protein cirp links inflammation and tumorigenesis in colitis-associated cancer.
25027624 2014 Protein overexpression of CIRP and TLR4 in oral squamous cell carcinoma: an immunohistochemical and clinical correlation analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097189 2013 Cold-inducible RNA-binding protein (CIRP) triggers inflammatory responses in hemorrhagic shock and sepsis.
23437386 2013 NF-?B-dependent role for cold-inducible RNA binding protein in regulating interleukin 1?.
More...