Property Summary

NCBI Gene PubMed Count 136
PubMed Score 453.99
PubTator Score 304.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.7e-04
interstitial cystitis 1.600 5.7e-03
lung adenocarcinoma -1.200 2.4e-07
lung cancer -1.800 5.0e-04
lung carcinoma -1.600 2.8e-33
non-small cell lung cancer -1.069 3.9e-11
osteosarcoma -2.936 2.1e-05
ovarian cancer 1.100 1.4e-07
periodontitis 1.100 5.5e-24
primary Sjogren syndrome 1.400 4.6e-03
psoriasis -1.800 1.3e-03
ulcerative colitis 1.400 1.2e-03

Protein-protein Interaction (5)

Gene RIF (124)

AA Sequence

MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAG      1 - 70
PSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNST     71 - 140
SVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQ    141 - 210
ASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTH    211 - 280
QDALQKFKQAKKGLLTLTVRTRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNY    281 - 350
RIMVEVSLQKEAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE    351 - 420
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLESSWHGRPTLEK    421 - 490
EREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASS    491 - 560
RLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPPPRKYFKSDSDPQKSLEERENSSCSSGHTPP    561 - 630
TCGQEARELLPLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQA    631 - 700
RMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKV    701 - 770
YKSADSSTVKKGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR    771 - 840
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQPEQVLSSGSPA    841 - 910
ASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSCETKLL    911 - 980
DEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLN    981 - 1050
LSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEE   1051 - 1120
GAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQ   1121 - 1190
AVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP   1191 - 1260
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAG   1261 - 1330
DS                                                                       1331 - 1332
//

Text Mined References (141)

PMID Year Title