Property Summary

NCBI Gene PubMed Count 129
Grant Count 153
R01 Count 82
Funding $15,426,723.68
PubMed Score 423.98
PubTator Score 304.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
psoriasis -1.800 0.001
osteosarcoma -3.706 0.000
periodontitis 1.100 0.000
non-small cell lung cancer -1.069 0.000
lung cancer -2.200 0.000
interstitial cystitis 1.600 0.006
primary Sjogren syndrome 1.400 0.005
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.600 0.000
ulcerative colitis 1.400 0.001
ovarian cancer 1.100 0.000

Synonym

Accession Q14005 A6NM20 A8MU65 B5TY35 B9EGR6 H3BVH5 Q16435 Q6VVE6 Q6ZMQ7 Q9UP18
Symbols LCF
NIL16
PRIL16
prIL-16

Gene

PDB

1I16   1X6D   5FB8  

 GWAS Trait (1)

Gene RIF (118)

PMID Text
26842762 IL-16 rs1131445 C/T polymorphism is related to the susceptibility to cancer in Asians (meta-analysis)
26823871 the results of our study suggested an association between the IL-16 rs4778889 polymorphism and an elevated risk of renal cell carcinoma
26615570 We observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26386715 The IL16 rs4072111 polymorphism may be associated with susceptibility to AD and the T allele may have a protective role in the progression of AD in an Iranian population.
26154181 the lack of a relationship between genotype and serum levels of IL-16 seems to suggest a more complex regulation of this cytokine at the post-translational level and/or the interplay with other cytokines.
25954818 The results suggested that the variants in IL-16 gene rs11556218 site were associated with a decreased knee osteoarthritis risk after adjusting for age, sex, BMI, and smoking and drinking status.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
25710036 Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity.
25166752 The findings suggest that the IL-16 rs 11556218 polymorphism may be used as a susceptibility marker for glioma.
25131111 There was no statistical significance between IL12B, IL16, and IL18 (rs187238) gene polymorphisms and kidney graft outcome after transplantation.
More...

AA Sequence

MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAG      1 - 70
PSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNST     71 - 140
SVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQ    141 - 210
ASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTH    211 - 280
QDALQKFKQAKKGLLTLTVRTRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNY    281 - 350
RIMVEVSLQKEAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE    351 - 420
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLESSWHGRPTLEK    421 - 490
EREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASS    491 - 560
RLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPPPRKYFKSDSDPQKSLEERENSSCSSGHTPP    561 - 630
TCGQEARELLPLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQA    631 - 700
RMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKV    701 - 770
YKSADSSTVKKGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR    771 - 840
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQPEQVLSSGSPA    841 - 910
ASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSCETKLL    911 - 980
DEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLN    981 - 1050
LSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEE   1051 - 1120
GAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQ   1121 - 1190
AVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP   1191 - 1260
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAG   1261 - 1330
DS                                                                       1331 - 1332
//

Text Mined References (134)

PMID Year Title
26842762 2016 Positive association between IL-16 rs1131445 polymorphism and cancer risk: a meta-analysis.
26823871 2015 Interleukin-16 rs4778889 polymorphism contributes to the development of renal cell cancer in a Chinese population.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26386715 2015 Association between polymorphisms in Interleukin-16 gene and risk of late-onset Alzheimer's disease.
26154181 2015 -295 T-to-C promoter region IL-16 gene polymorphism is associated with Whipple's disease.
25954818 2015 Genetic polymorphisms of interleukin-16 and risk of knee osteoarthritis.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25710036 2015 Elevated plasma levels of interleukin-12p40 and interleukin-16 in overweight adolescents.
25166752 2014 Interleukin-16 polymorphism is associated with an increased risk of glioma.
25131111 The impact of interleukin 12B (1188A>C), interleukin 16 (-295T>C), and interleukin 18 (607C>A, 137G>C) gene polymorphisms on long-term renal transplant function and recipient outcomes.
More...