Property Summary

NCBI Gene PubMed Count 129
PubMed Score 423.98
PubTator Score 304.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 2.8450950146064E-33
periodontitis 269 5.50873223269676E-24
osteosarcoma 7933 2.89300233532978E-12
non-small cell lung cancer 2798 3.92347101889783E-11
ovarian cancer 8492 1.37933935010886E-7
lung adenocarcinoma 2714 2.43205594953529E-7
lung cancer 4473 3.51048548095044E-5
hepatocellular carcinoma 550 1.68322398110541E-4
ulcerative colitis 2087 0.00124033424053851
psoriasis 6685 0.00134428254855089
primary Sjogren syndrome 789 0.00463012330298432
interstitial cystitis 2299 0.00567595679379621
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 3.719 1.9
Whipple disease 5 3.56 1.8
Graves' disease 25 3.302 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
psoriasis -1.800 0.001
osteosarcoma -3.706 0.000
periodontitis 1.100 0.000
non-small cell lung cancer -1.069 0.000
lung cancer -2.200 0.000
interstitial cystitis 1.600 0.006
primary Sjogren syndrome 1.400 0.005
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.600 0.000
ulcerative colitis 1.400 0.001
ovarian cancer 1.100 0.000

Synonym

Accession Q14005 A6NM20 A8MU65 B5TY35 B9EGR6 H3BVH5 Q16435 Q6VVE6 Q6ZMQ7 Q9UP18
Symbols LCF
NIL16
PRIL16
prIL-16

Gene

PDB

1I16   1X6D   5FB8  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (118)

PMID Text
26842762 IL-16 rs1131445 C/T polymorphism is related to the susceptibility to cancer in Asians (meta-analysis)
26823871 the results of our study suggested an association between the IL-16 rs4778889 polymorphism and an elevated risk of renal cell carcinoma
26615570 We observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26386715 The IL16 rs4072111 polymorphism may be associated with susceptibility to AD and the T allele may have a protective role in the progression of AD in an Iranian population.
26154181 the lack of a relationship between genotype and serum levels of IL-16 seems to suggest a more complex regulation of this cytokine at the post-translational level and/or the interplay with other cytokines.
25954818 The results suggested that the variants in IL-16 gene rs11556218 site were associated with a decreased knee osteoarthritis risk after adjusting for age, sex, BMI, and smoking and drinking status.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
25710036 Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity.
25166752 The findings suggest that the IL-16 rs 11556218 polymorphism may be used as a susceptibility marker for glioma.
25131111 There was no statistical significance between IL12B, IL16, and IL18 (rs187238) gene polymorphisms and kidney graft outcome after transplantation.
More...

AA Sequence

MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAG      1 - 70
PSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNST     71 - 140
SVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQ    141 - 210
ASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTH    211 - 280
QDALQKFKQAKKGLLTLTVRTRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNY    281 - 350
RIMVEVSLQKEAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE    351 - 420
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLESSWHGRPTLEK    421 - 490
EREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASS    491 - 560
RLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPPPRKYFKSDSDPQKSLEERENSSCSSGHTPP    561 - 630
TCGQEARELLPLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQA    631 - 700
RMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKV    701 - 770
YKSADSSTVKKGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR    771 - 840
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQPEQVLSSGSPA    841 - 910
ASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSCETKLL    911 - 980
DEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLN    981 - 1050
LSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEE   1051 - 1120
GAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQ   1121 - 1190
AVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP   1191 - 1260
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAG   1261 - 1330
DS                                                                       1331 - 1332
//

Text Mined References (134)

PMID Year Title
26842762 2016 Positive association between IL-16 rs1131445 polymorphism and cancer risk: a meta-analysis.
26823871 2015 Interleukin-16 rs4778889 polymorphism contributes to the development of renal cell cancer in a Chinese population.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26386715 2015 Association between polymorphisms in Interleukin-16 gene and risk of late-onset Alzheimer's disease.
26154181 2015 -295 T-to-C promoter region IL-16 gene polymorphism is associated with Whipple's disease.
25954818 2015 Genetic polymorphisms of interleukin-16 and risk of knee osteoarthritis.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25710036 2015 Elevated plasma levels of interleukin-12p40 and interleukin-16 in overweight adolescents.
25166752 2014 Interleukin-16 polymorphism is associated with an increased risk of glioma.
25131111 The impact of interleukin 12B (1188A>C), interleukin 16 (-295T>C), and interleukin 18 (607C>A, 137G>C) gene polymorphisms on long-term renal transplant function and recipient outcomes.
More...