Property Summary

NCBI Gene PubMed Count 28
Grant Count 24
R01 Count 21
Funding $1,188,959.97
PubMed Score 17.38
PubTator Score 12.86

Knowledge Summary

Patent (2,689)

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
astrocytic glioma 2.600 0.004
ependymoma 2.800 0.002
oligodendroglioma 2.700 0.001
osteosarcoma 2.172 0.000
medulloblastoma 1.100 0.000
juvenile dermatomyositis 1.042 0.000
pancreatic ductal adenocarcinoma liver m... 2.683 0.000
Pick disease 1.600 0.000
ovarian cancer -1.700 0.001
Gaucher disease type 1 -1.400 0.003

Gene RIF (10)

PMID Text
26886422 CDK13 gene is amplified in different types of cancer indicate that this kinase can contribute to cancer development in human.
25561469 CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response.
25216700 High CDK13 expression is associated with pancreatic cancer.
22912832 Coincidently amplified CDK13, GMNN, and CENPF genes can play a role as common cancer-driver genes in human cancers.
22547058 CDK13 interacts with cyclin K, and is required for self-renewal in ES cells.
18480452 Cyclin-dependent kinase 13 (CDK13) upregulates HIV-1 mRNA splicing and favors the production of the doubly spliced protein Nef
18480452 Cyclin-dependent kinase 13 (CDK13) upregulates HIV-1 mRNA splicing and favors the production of the doubly spliced protein Nef
18480452 Cyclin-dependent kinase 13 (CDK13) upregulates HIV-1 mRNA splicing and favors the production of the doubly spliced protein Nef
18480452 Cyclin-dependent kinase 13 (CDK13) upregulates HIV-1 mRNA splicing and favors the production of the doubly spliced protein Nef
16721827 Data demonstrate that CDC2L5 is located in the nucleoplasm, where it directly interacts with the ASF/SF2-associated protein p32, a protein involved in splicing regulation.

AA Sequence

MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLFLAAPGTAAAA      1 - 70
AAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRVFSLPQPQQDGGGGASSGGGV     71 - 140
TPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGSPASSSGTQRRGEGSERRPRRDRRSSSGRSK    141 - 210
ERHREHRRRDGQRGGSEASKSRSRHSHSGEERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHR    211 - 280
SRTKSSKEPPSAYKEPPKAYREDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSP    281 - 350
YSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS    351 - 420
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKAS    421 - 490
NTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKTKPPLQVTKVENNLIVDKATKK    491 - 560
AVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPMLPEDKEADSLRGNIS    561 - 630
VKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKR    631 - 700
CVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEI    701 - 770
VTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC    771 - 840
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTK    841 - 910
KPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLA    911 - 980
LDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLG    981 - 1050
LDDSRTNTPQGVLPSSQLKSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNS   1051 - 1120
ETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQL   1121 - 1190
IKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR   1191 - 1260
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYV   1261 - 1330
STSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESF   1331 - 1400
PSSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPIAVLANSSDPSTGPESTHPLPAKMHNYNYGGNLQENP   1401 - 1470
SGPSLMHGQTWTSPAQGPGYSQGYRGHISTSTGRGRGRGLPY                               1471 - 1512
//

Text Mined References (44)

PMID Year Title
26886422 2016 CDK13, a Kinase Involved in Pre-mRNA Splicing, Is a Component of the Perinucleolar Compartment.
26748711 2016 Structural and Functional Analysis of the Cdk13/Cyclin K Complex.
25561469 2015 Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.
25216700 2015 Protein deep sequencing applied to biobank samples from patients with pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912832 2012 Frequent amplification of CENPF, GMNN and CDK13 genes in hepatocellular carcinomas.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22547058 2012 Cyclin K-containing kinase complexes maintain self-renewal in murine embryonic stem cells.
More...