Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.24
PubTator Score 18.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -3.400 1.1e-02
lung adenocarcinoma 1.200 1.2e-04
nasopharyngeal carcinoma -1.600 2.7e-04
non-small cell lung cancer 1.150 3.4e-04
pancreatic cancer 1.700 2.0e-02
primary pancreatic ductal adenocarcinoma 2.488 1.1e-02
psoriasis -1.200 1.5e-09
ulcerative colitis -1.800 3.6e-05

Gene RIF (5)

AA Sequence

MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG      1 - 70
ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFY     71 - 140
VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND    141 - 210
IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI                   211 - 265
//

Text Mined References (33)

PMID Year Title