Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.83
PubTator Score 18.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 2.488 0.011
non-small cell lung carcinoma 1.500 0.000
colon cancer -4.600 0.001
pancreatic cancer 2.300 0.017
lung adenocarcinoma 1.200 0.000
nasopharyngeal carcinoma -1.600 0.000
psoriasis -1.800 0.000
ulcerative colitis -2.000 0.000

Gene RIF (4)

PMID Text
26323304 crystal structure of the N-terminal dimerization domain of CEACAM has been determined at 1.47 A resolution
22195770 High CEACAM7 is associated with gastric carcinoma.
20004437 CEACAM-7 expression is significantly decreased in rectal cancer; a potential tumor marker
16627067 CGM2 RT-PCR assay provides no specific prognostic information and cannot be used as a decision criterion for adjuvant therapy after colorectal cancer surgery.

AA Sequence

MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG      1 - 70
ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFY     71 - 140
VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND    141 - 210
IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI                   211 - 265
//

Text Mined References (32)

PMID Year Title
26323304 2015 Structure of the N-terminal dimerization domain of CEACAM7.
25152032 2014 Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) is specifically expressed in medullary thyroid carcinoma cells.
22984996 2012 Distribution of carcinoembryonic antigen-related cellular adhesion molecules in human gingiva.
22195770 2011 Dynamic expression of CEACAM7 in precursor lesions of gastric carcinoma and its prognostic value in combination with CEA.
20004437 2010 CEACAM-7: a predictive marker for rectal cancer recurrence.
19170965 2009 Contribution of intestinal epithelial cells to innate immunity of the human gut--studies on polarized monolayers of colon carcinoma cells.
18254958 2008 Transcriptomic dissection of tongue squamous cell carcinoma.
17517873 2007 Opa proteins of pathogenic neisseriae initiate Src kinase-dependent or lipid raft-mediated uptake via distinct human carcinoembryonic antigen-related cell adhesion molecule isoforms.
16755296 2006 Biomarker selection for detection of occult tumour cells in lymph nodes of colorectal cancer patients using real-time quantitative RT-PCR.
16627067 2006 Long-term prognostic value of detection of circulating colorectal cancer cells using CGM2 reverse transcriptase-polymerase chain reaction assay.
More...