Property Summary

NCBI Gene PubMed Count 140
Grant Count 711
R01 Count 496
Funding $87,532,323.15
PubMed Score 418.83
PubTator Score 463.16

Knowledge Summary

Patent (109,670)

Expression

Synonym

Accession Q13976 A5YM56 B3KSF3 E2PU10 P14619 Q5JP05 Q5JSJ6 Q6P5T7 cGK 1
Symbols PKG
cGK
AAT8
cGK1
cGKI
cGK 1
PRKG1B
PRKGR1B
cGKI-BETA
cGKI-alpha

Gene

PDB

1ZXA   3NMD   3OCP   3OD0   3OGJ   4KU7   4KU8   4QX5   4QXK   4R4L   4R4M   4Z07  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (93)

PMID Text
26370085 cAMP is a partial agonist for PKG, and we elucidate the mechanism for cAMP partial agonism through the comparative NMR analysis of the apo, cGMP-, and cAMP-bound forms of the PKG cyclic nucleotide-binding domain B.
26132214 The C42-C42' disulfide bond dramatically stabilizes PRKG1.
25900831 Protein kinase G has a role in regulating production of H2S, which governs oxygen sensing
25855081 The Golgi apparatus regulates PKGIalpha compartmentation and proteolysis.
25447536 miR-20a expression is up-regulated in response to hypoxia in both mouse and human pulmonary arterial smooth muscle cells
25338677 Study of genetic heterogeneity in systemic lupus erythematosus, the top associations in European ancestry were protein kinase, cyclic GMP-dependent, type I (PRKG1) rs7897633 (P(Meta) = 2.75 x 10(-8)) and purine nucleoside phosphorylase (PNP) rs1049564 (P(Meta) = 1.24 x 10(-7)).
25273530 Expression levels of miR-517a-3p and its target mRNA PRKG1 were inversely correlated in NK cells before and after obstetric delivery.
25271401 Neutron diffraction reveals hydrogen bonds critical for cGMP-selective activation: insights for cGMP-dependent protein kinase agonist design.
24826884 Data show that functional cGMP/protein kinase G type 1 (PKG1) is expressed in pancreatic adenocarcinoma cells.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
More...

AA Sequence

MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTRAQGISAEPQT      1 - 70
YRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLV     71 - 140
YVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHT    141 - 210
EYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVF    211 - 280
LRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAA    281 - 350
FFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF    351 - 420
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENL    421 - 490
ILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSG    491 - 560
PDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKG    561 - 630
TLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF                                 631 - 671
//

Text Mined References (149)

PMID Year Title
26370085 2015 Mechanism of cAMP Partial Agonism in Protein Kinase G (PKG).
26132214 2015 Structures of cGMP-Dependent Protein Kinase (PKG) I? Leucine Zippers Reveal an Interchain Disulfide Bond Important for Dimer Stability.
25900831 2015 Protein kinase G-regulated production of H2S governs oxygen sensing.
25855081 2015 The Golgi apparatus regulates cGMP-dependent protein kinase I compartmentation and proteolysis.
25447536 2014 MiR-20a regulates the PRKG1 gene by targeting its coding region in pulmonary arterial smooth muscle cells.
25416956 2014 A proteome-scale map of the human interactome network.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25273530 2014 Human exosomal placenta-associated miR-517a-3p modulates the expression of PRKG1 mRNA in Jurkat cells.
25271401 2014 Neutron diffraction reveals hydrogen bonds critical for cGMP-selective activation: insights for cGMP-dependent protein kinase agonist design.
More...