Property Summary

Ligand Count 8
NCBI Gene PubMed Count 148
PubMed Score 459.36
PubTator Score 463.16

Knowledge Summary

Patent (109,670)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Asthma 385 0.0 2.0
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 0.0 5.0
Disease Target Count Z-score Confidence
Aortic aneurysm 38 0.0 4.0
Disease Target Count Z-score Confidence
Impotence 42 3.88 1.9
Hypertension 396 3.049 1.5

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.471 3.3e-03
colon cancer -1.700 1.7e-03
cystic fibrosis 2.220 1.3e-06
ependymoma 1.200 5.4e-06
group 4 medulloblastoma -1.700 1.6e-05
intraductal papillary-mucinous adenoma (... -1.100 7.2e-03
intraductal papillary-mucinous carcinoma... -1.500 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.0e-02
lung adenocarcinoma -1.300 1.4e-12
lung cancer -1.900 1.3e-04
lung carcinoma -1.300 2.3e-09
malignant mesothelioma -2.100 9.3e-07
non-small cell lung cancer -1.020 7.8e-10
osteosarcoma 1.885 8.5e-06
ovarian cancer -2.500 4.0e-09
pituitary cancer -1.100 1.1e-03

Protein-protein Interaction (2)

PDB (16)

Gene RIF (99)

AA Sequence

MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTRAQGISAEPQT      1 - 70
YRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLV     71 - 140
YVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHT    141 - 210
EYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVF    211 - 280
LRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAA    281 - 350
FFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF    351 - 420
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENL    421 - 490
ILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSG    491 - 560
PDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKG    561 - 630
TLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF                                 631 - 671
//

Text Mined References (156)

PMID Year Title