Property Summary

NCBI Gene PubMed Count 42
PubMed Score 95.34
PubTator Score 94.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 1.7e-04
astrocytoma -1.300 1.8e-16
Astrocytoma, Pilocytic -2.300 3.3e-10
atypical teratoid / rhabdoid tumor -2.100 1.4e-09
Chronic Lymphocytic Leukemia 1.134 4.0e-03
ependymoma -2.000 5.2e-14
glioblastoma -2.000 3.8e-11
group 3 medulloblastoma -2.600 2.0e-05
interstitial lung disease 1.600 7.1e-03
lung cancer -1.600 3.3e-03
malignant mesothelioma 4.200 1.4e-08
medulloblastoma, large-cell -1.800 3.3e-05
non-small cell lung cancer -2.206 2.6e-27
oligodendroglioma -1.300 3.4e-10
Pick disease -2.000 1.6e-03
primitive neuroectodermal tumor -2.200 1.1e-05

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEG      1 - 70
CVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALM     71 - 140
QKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQ    141 - 210
SFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPP    211 - 280
ITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHC    281 - 350
KQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS    351 - 420
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGER    421 - 490
QCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPF    491 - 560
TVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCD    561 - 630
DVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPIS    631 - 700
AIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKAL    701 - 770
DLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE    771 - 840
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIAT    841 - 910
AGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVI    911 - 980
GFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLD    981 - 1050
HLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADIC   1051 - 1120
RCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYL   1121 - 1190
GMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL   1191 - 1260
YESSLRIEPKLPT                                                            1261 - 1273
//

Text Mined References (44)

PMID Year Title