Property Summary

NCBI Gene PubMed Count 39
Grant Count 298
R01 Count 227
Funding $30,409,435.42
PubMed Score 92.38
PubTator Score 94.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease 1.600 0.007
Chronic Lymphocytic Leukemia 1.134 0.004
malignant mesothelioma 4.200 0.000
astrocytoma -1.300 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.300 0.000
ependymoma -2.000 0.000
group 3 medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -2.200 0.000
non-small cell lung cancer -2.206 0.000
lung cancer -3.300 0.000
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -2.400 0.000
Pick disease -2.000 0.002

Synonym

Accession Q13972 F8VPA5 H0YKF2 J3KQP9 Q16027 Ras-GRF1
Symbols GNRP
GRF1
CDC25
GRF55
CDC25L
H-GRF55
PP13187
ras-GRF1

Gene

Gene RIF (20)

PMID Text
26644762 Carriers of the rs8027411 G allele in the RASGRF1 gene may be at a lower risk of high myopia in Chinese and Japanese populations. (Meta-analysis)
26521038 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
25267792 CARD9 regulates H-Ras activation by linking Ras-GRF1 to H-Ras, which mediates Dectin-1-induced extracellular signal-regulated protein kinase (ERK) activation and proinflammatory responses when stimulated by their ligands.
24597981 Rasgrf-1 is a novel GEF protein that has a role in BCR signaling and its overexpression further activates the Ras/Erk/MAPK pathway in CLL specimens.
24150758 ZIC2 and RASGRF1 are susceptibility genes, not only for common myopia, but also for high myopia.
23834555 In this study, there was no association of the analyzed SNPs located in RASGRF1. GJD2, and ACTC1 with pathological myopia.
23200899 Decreased expression of Ras-GRF1 could be involved in the pathogenesis of human temporal lobe epilepsy.
22961779 Aberrant methylation of RASGRF1 is associated with an epigenetic field defect and increased risk of gastric cancer.
22752028 RasGRF1 plays an important role in alveolar rhabdomyosarcoma pathogenesis
21685891 Demonstrate a role for RasGRF1/2 as negative regulators of Cdc42 activation, suppressing tumor cell movement, cytoskeletal dynamics and cell transformation.
More...

AA Sequence

MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEG      1 - 70
CVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALM     71 - 140
QKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQ    141 - 210
SFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPP    211 - 280
ITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHC    281 - 350
KQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS    351 - 420
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGER    421 - 490
QCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPF    491 - 560
TVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCD    561 - 630
DVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPIS    631 - 700
AIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKAL    701 - 770
DLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE    771 - 840
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIAT    841 - 910
AGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVI    911 - 980
GFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLD    981 - 1050
HLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADIC   1051 - 1120
RCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYL   1121 - 1190
GMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL   1191 - 1260
YESSLRIEPKLPT                                                            1261 - 1273
//

Text Mined References (41)

PMID Year Title
26644762 2015 Polymorphism in the RASGRF1 gene with high myopia: A meta-analysis.
26521038 2016 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
25267792 2014 CARD9 mediates Dectin-1-induced ERK activation by linking Ras-GRF1 to H-Ras for antifungal immunity.
24597981 2014 Amplification of B cell receptor-Erk signaling by Rasgrf-1 overexpression in chronic lymphocytic leukemia.
24150758 2013 Association between ZIC2, RASGRF1, and SHISA6 genes and high myopia in Japanese subjects.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23834555 2015 Evaluating the association between pathological myopia and SNPs in RASGRF1. ACTC1 and GJD2 genes at chromosome 15q14 and 15q25 in a Chinese population.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23200899 2013 Decreased expression of Ras-GRF1 in the brain tissue of the intractable epilepsy patients and experimental rats.
22961779 2012 Aberrant methylation of RASGRF1 is associated with an epigenetic field defect and increased risk of gastric cancer.
More...