Property Summary

Ligand Count 1
NCBI Gene PubMed Count 13
PubMed Score 7.37
PubTator Score 6.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 4.100 3.8e-06
osteosarcoma -2.281 4.2e-06
pituitary cancer 1.400 3.0e-02

Gene RIF (3)

AA Sequence

MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFS      1 - 70
HLELHELAQFGII                                                              71 - 83
//

Text Mined References (12)

PMID Year Title