Property Summary

NCBI Gene PubMed Count 36
Grant Count 16
R01 Count 13
Funding $1,232,001.54
PubMed Score 71.67
PubTator Score 32.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26509926 Presence of NF-Y transcription factor plays a pivotal role in transcriptional regulation of ID genes in development.
25965574 TAF12 and NFYC are transcription factors that regulate the epigenome, whereas RAD54L plays a central role in DNA repair
23657974 the expression of the adipogenic differentiation genes fatty acid binding protein-4, adiponectin, and leptin and the formation of fat droplets were impaired.
23332751 The crystal structure of NF-Y bound to a 25 bp CCAAT oligonucleotide shows that the histone-fold domains dimer binds to the DNA sugar-phosphate backbone, mimicking the nucleosome H2A/H2B-DNA assembly; NF-YA both binds to NF-YB/NF-YC and inserts an alpha helix deeply into the DNA minor groove, providing sequence-specific contacts to the CCAAT box.
22412893 Sp1, NF-Y and FOXO transcription factors are involved in the regulation of LKB1 transcription.
22104449 NFY-C expression was elevated in colorectal adenocarcinomas; moreover, NFY-C mRNA levels correlated with time to disease progression, while NFY-C protein expression was significantly higher in metastatic disease
20965718 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
20054001 NF-YC functions as a new corepressor of agonist-bound mineralocorticoid receptor via alteration of aldosterone-induced MR conformation
19690168 NF-YC complexity is generated by dual promoters and alternative splicing
More...

AA Sequence

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFA      1 - 70
KAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAE     71 - 140
PVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQG    141 - 210
QAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRN    211 - 280
ASQGKPRRCLKETLQITQTEVQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLP    281 - 350
TTHPPSHRAGASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ    351 - 420
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD                                    421 - 458
//

Text Mined References (38)

PMID Year Title
26509926 2015 Epigenetic role of CCAAT box-binding transcription factor NF-Y on ID gene family in human embryonic carcinoma cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25965574 2015 Cross-Species Genomics Identifies TAF12, NFYC, and RAD54L as Choroid Plexus Carcinoma Oncogenes.
23657974 2014 Adipogenic differentiation is impaired in replicative senescent human subcutaneous adipose-derived stromal/progenitor cells.
23332751 2013 Sequence-specific transcription factor NF-Y displays histone-like DNA binding and H2B-like ubiquitination.
22412893 2012 Gene expression of the tumour suppressor LKB1 is mediated by Sp1, NF-Y and FOXO transcription factors.
22104449 2012 Altered expression of NFY-C and RORA in colorectal adenocarcinomas.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21269460 2011 Initial characterization of the human central proteome.
More...