Property Summary

Ligand Count 5
NCBI Gene PubMed Count 77
PubMed Score 5.82
PubTator Score 203.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.557 1.1e-07
Amyotrophic lateral sclerosis 1.035 2.6e-07
Astrocytoma, Pilocytic 1.200 2.7e-06
atypical teratoid / rhabdoid tumor 1.300 6.0e-06
Down syndrome 1.600 7.5e-04
ependymoma 1.100 5.5e-06
glioblastoma 1.200 1.2e-06
group 4 medulloblastoma 1.100 2.0e-04
juvenile dermatomyositis 1.152 2.1e-12
medulloblastoma, large-cell 1.400 4.4e-05
osteosarcoma 1.507 1.5e-02
ovarian cancer -1.500 1.1e-04
pediatric high grade glioma 1.200 5.0e-04
ulcerative colitis 1.500 1.2e-06
Waldenstrons macroglobulinemia 1.496 1.1e-02

 GO Component (2)

Protein-protein Interaction (3)

Gene RIF (88)

AA Sequence

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP      1 - 70
ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ     71 - 140
QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP                                141 - 182
//

Text Mined References (85)

PMID Year Title