Property Summary

NCBI Gene PubMed Count 70
Grant Count 114
R01 Count 73
Funding $9,760,570.59
PubMed Score 5.68
PubTator Score 203.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.496 0.011
osteosarcoma 1.507 0.015
ependymoma 1.100 0.000
glioblastoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
juvenile dermatomyositis 1.152 0.000
Amyotrophic Lateral Sclerosis 1.035 0.000
acute quadriplegic myopathy 1.557 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000
ulcerative colitis 1.500 0.000
ovarian cancer 2.200 0.001
Down syndrome 1.600 0.001

Synonym

Accession Q13951 A8K347 Q13124 Q9HCT2 CBF-beta
Symbols PEBP2B

Gene

PDB

1CL3   1E50   1H9D   4N9F  

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1434 confirmatory 1621 / 0 / 216765 uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a fluorescence resonance energy transfer (FRET) assay.
1438 confirmatory 45 / 0 / 2179 Identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1496 screening 993 / 0 / 214825 uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb via a fluorescence resonance energy transfer (FRET) assay.
1502 screening 75 / 0 / 400 Identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1550 confirmatory 4 / 0 / 2 Confirmation of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1560 confirmatory 9 / 0 / 4 Confirmation of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a fluorescence resonance energy transfer (FRET) assay
1639 summary 0 / 0 / 0 Summary of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb
1645 summary 0 / 0 / 0 Summary of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC
504370 confirmatory 24 / 33 / 82 qHTS Assay for Compounds Blocking the Interaction Between CBF-beta and RUNX1 for the Treatment of Acute Myeloid Leukemia: ME-1 cellular proliferation
504371 confirmatory 4 / 1 / 1 qHTS Assay for Compounds Blocking the Interaction Between CBF-beta and RUNX1 for the Treatment of Acute Myeloid Leukemia: ME-1 cellular proliferation, SAR for Probe
More...

Gene RIF (136)

PMID Text
26418744 Thus, an NGF/TrkA-MAPK-CBFbeta pathway converges with Islet1-Runx1 signaling to promote Runx1/CBFbeta holocomplex formation and nonpeptidergic nociceptor maturation.
26241003 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
26163765 Our findings demonstrate that HSPCs exposed to non-cytotoxic levels of environmental chemicals and chemotherapeutic agents are prone to topoisomerase II-mediated DNA damage at the leukemia-associated genes MLL and CBFB.
25981045 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25981045 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25582776 CBF-beta promoted steady-state levels of HIV-1 Vif by inhibiting the degradation of HIV-1 Vif through the proteasome pathway.
25582776 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25582776 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
More...

AA Sequence

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP      1 - 70
ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ     71 - 140
QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP                                141 - 182
//

Text Mined References (78)

PMID Year Title
26418744 2015 Extrinsic and intrinsic signals converge on the Runx1/CBF? transcription factor for nonpeptidergic nociceptor maturation.
26163765 2015 Environmental and chemotherapeutic agents induce breakage at genes involved in leukemia-causing gene rearrangements in human hematopoietic stem/progenitor cells.
25582776 2015 Multiple lysines combined in HIV-1 Vif determines the responsiveness to CBF-?.
25424878 2014 Requirement of HIV-1 Vif C-terminus for Vif-CBF-? interaction and assembly of CUL5-containing E3 ligase.
25266220 2014 CBFB-MYH11 hypomethylation signature and PBX3 differential methylation revealed by targeted bisulfite sequencing in patients with acute myeloid leukemia.
25122780 2014 Core-binding factor subunit beta is not required for non-primate lentiviral Vif-mediated APOBEC3 degradation.
25079347 2014 CBF? and the leukemogenic fusion protein CBF?-SMMHC associate with mitotic chromosomes to epigenetically regulate ribosomal genes.
24651404 2014 Activation of HIV-1 from latent infection via synergy of RUNX1 inhibitor Ro5-3335 and SAHA.
24648201 2014 Core binding factor ? (CBF?) is retained in the midbody during cytokinesis.
24522927 2014 CBF? enhances de novo protein biosynthesis of its binding partners HIV-1 Vif and RUNX1 and potentiates the Vif-induced degradation of APOBEC3G.
More...