Property Summary

NCBI Gene PubMed Count 359
Grant Count 885
R01 Count 581
Funding $92,328,304.44
PubMed Score 2146.24
PubTator Score 1295.31

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13950 O14614 O14615 O95181
Symbols CCD
AML3
CCD1
CLCD
OSF2
CBFA1
OSF-2
PEA2aA
PEBP2aA
CBF-alpha-1

Gene

PANTHER Protein Class (1)

Gene RIF (324)

PMID Text
26925584 RUNX2 mediates epigenetic regulation of the survival of p53 defective osteosarcoma cells.
26809090 Our findings suggest that suppression of miR-222-3p activity promoted osteogenic differentiation hBMSCs through regulating Smad5-RUNX2 signaling axis.
26782468 An osteogenic medium is required for the differentiation of adul tmesenchymal stem cells, which is also under RUNX2 regulation. These findings are potentially valuable for clinical practice.
26759258 FHL2 might interact with Runx2 to mediate mesenchymal cell differentiation at the early stages of tooth development and human dental pulp cell differentiation.
26729095 Runx2 activation by BMP signaling mediates serum deprivation triggers upregulation of hST3Gal V gene expression in MG-63 cells.
26660506 GnRH regulates trophoblast invasion via RUNX2-mediated MMP2/MMP9 expression.
26553695 This integrative genomic study confirmed the role of RUNX2 as a potential driver of AS and identified a new AS susceptibility gene, CACNA1C, belonging to the calcium signaling pathway.
26551078 that STAT-5, RUNX-2, and FGFR-2 may have a role in the progression of the mucinous phenotype, in which nuclear STAT-5 may inhibit RUNX-2 prometastatic effect
26528706 Runx2 provides a chemoprotective role in OS.
26413977 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
More...

AA Sequence

MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQ      1 - 70
QEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAF     71 - 140
KVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV    141 - 210
ATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQ    211 - 280
GQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFC    281 - 350
LWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHT    351 - 420
YLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQ    421 - 490
NDGVDADGSHSSSPTVLNSSGRMDESVWRPY                                           491 - 521
//

Text Mined References (361)

PMID Year Title
26925584 2016 A RUNX2-Mediated Epigenetic Regulation of the Survival of p53 Defective Cancer Cells.
26809090 2016 Inhibition of miR-222-3p activity promoted osteogenic differentiation of hBMSCs by regulating Smad5-RUNX2 signal axis.
26782468 2015 Genetic expression and functional characterization of the RUNX2 gene in human adult bone marrow mesenchymal stem cells.
26759258 2016 FHL2 mediates tooth development and human dental pulp cell differentiation into odontoblasts, partially by interacting with Runx2.
26729095 2015 Serum Deprivation-Induced Human GM3 Synthase (hST3Gal V) Gene Expression Is Mediated by Runx2 in Human Osteoblastic MG-63 Cells.
26660506 2016 GnRH regulates trophoblast invasion via RUNX2-mediated MMP2/9 expression.
26553695 2015 Calcium Signaling Pathway Genes RUNX2 and CACNA1C Are Associated With Calcific Aortic Valve Disease.
26551078 2016 Nuclear staining of fgfr-2/stat-5 and runx-2 in mucinous breast cancer.
26528706 2015 Loss of Runx2 sensitises osteosarcoma to chemotherapy-induced apoptosis.
26413977 2016 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
More...