Property Summary

NCBI Gene PubMed Count 82
Grant Count 1,058
R01 Count 663
Funding $92,534,988.87
PubMed Score 421.36
PubTator Score 800.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13948 B3KWH3 B3KWH8 B4DZZ2 G3V1Z6 J3KPQ6 Q53GU9 Q8TBS3
Symbols CDP
CUX
p75
CASP
CDP1
COY1
Clox
p100
p110
p200
CUTL1
GOLIM6
CDP/Cut
Cux/CDP
Nbla10317

Gene

Gene RIF (53)

PMID Text
25248790 High CUX1 expression is associated with metastasis in pancreatic neuroendocrine neoplasms.
25190083 CUX1 expression is associated with tumour progression and tumor burden. [Review]
25159843 CASP is specifically cleaved by granzymeB.
25124494 This is a novel gene implicated in atrial fibrillation
25096634 Results show that Cux1 is expressed in cerebellar granule cell precursors and downregulated as they terminally differentiate; coexpression analysis in human medulloblastomas suggests another function related to DNA integrity and stability
24686420 Suggest that CUTL1 may regulate the proliferation of malignant melanoma by modulating the expression of cell cycle-related proteins.
24429498 Loss of CUX1 is associated with myeloid neoplasms.
24336331 Authors identified CUX1 as an important modulator of the TAMs phenotype and function by modulating NF-kappaB-dependent cytokines.
24316979 Cux1 is a tumor suppressor and inactivating CUX1 mutations promote tumorigenesis.
23590133 p110 CUX1 can mediate transcriptional repression or activation of specific genes when bound at variable distances from the transcription start site.
More...

AA Sequence

MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKS      1 - 70
FQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEF     71 - 140
AEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQS    141 - 210
LQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQ    211 - 280
IQKAPDVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLK    281 - 350
QLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGR    351 - 420
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPAS    421 - 490
GALPEGQVDSLLSIISSQRERFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGR    491 - 560
GSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTIGFFYTLFLHC    561 - 630
LVFLVLYKLAWSESMERDCATFCAKKFADHLHKFHENDNGAAAGDLWQ                          631 - 678
//

Text Mined References (87)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25248790 2014 CUX1: a modulator of tumour aggressiveness in pancreatic neuroendocrine neoplasms.
25190083 2014 CUX1, a haploinsufficient tumour suppressor gene overexpressed in advanced cancers.
25159843 2014 Cytohesin-associated scaffolding protein (CASP) is a substrate for granzyme B and ubiquitination.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
25096634 2014 The transcription factor Cux1 in cerebellar granule cell development and medulloblastoma pathogenesis.
24686420 2014 The transcription factor CUTL1 is associated with proliferation and prognosis in malignant melanoma.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
24336331 2015 CUX1 modulates polarization of tumor-associated macrophages by antagonizing NF-?B signaling.
24316979 2014 Inactivating CUX1 mutations promote tumorigenesis.
More...