Property Summary

NCBI Gene PubMed Count 25
PubMed Score 84.85
PubTator Score 65.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.1e-03
group 3 medulloblastoma 1.700 1.5e-04
invasive ductal carcinoma 1.700 2.3e-02
lung carcinoma -1.400 5.3e-22
medulloblastoma, large-cell 1.900 1.2e-04
ovarian cancer -1.200 1.3e-02
primitive neuroectodermal tumor 1.100 8.8e-03
tuberculosis -1.500 2.3e-05
ulcerative colitis 1.300 4.0e-04

 MGI Phenotype (1)

Gene RIF (11)

AA Sequence

MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTALYIRMLGDVR      1 - 70
VRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDY     71 - 140
NGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNP    141 - 210
YHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSV    211 - 280
LENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHR    281 - 350
HLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL    351 - 420
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS            421 - 482
//

Text Mined References (29)

PMID Year Title