Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
R01 Count 4
Funding $452,547.83
PubMed Score 82.59
PubTator Score 65.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13946 A0AVH6 A8K436 A8K9G5 O15380 Q96T72
Symbols HCP1
PDE7

Gene

PANTHER Protein Class (2)

PDB

1ZKL   3G3N   4PM0   4Y2B  

Gene RIF (10)

PMID Text
25128584 PDE7A is a high-speed and low-affinity phosphodiesterase for cCMP.
23661015 PDE7 has roles in regulating oligodendrocyte precursor survival and differentiation during brain development and in adulthood
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18420479 results show that specific gene silencing with the RNAi method is a useful tool for inhibiting the gene expression of specific PDEs and that PDE7 silencing upregulates several osteogenic genes and increases mineralization
15994308 crystal structure of PDE7A1 catalytic domain complexed with the inhibitor 3-isobutyl-1-methylxanthine & kinetic analysis on mutant PDE7A1 and PDE4D2; results show several residues must work together to switch inhibitor selectivity between PDE4 & PDE7
12388353 Ubiquitous expression of phosphodiesterase 7A in human proinflammatory and immune cells; PDE7A was expressed in neutrophils and alveolar macrophages
12067300 PDE7 has the potential to regulate human T cell function including cytokine production, proliferation and expression of activation markers.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTALYIRMLGDVR      1 - 70
VRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDY     71 - 140
NGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNP    141 - 210
YHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSV    211 - 280
LENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHR    281 - 350
HLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL    351 - 420
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS            421 - 482
//

Text Mined References (28)

PMID Year Title
25128584 2014 PDE7A1 hydrolyzes cCMP.
23661015 2013 Inhibition of endogenous phosphodiesterase 7 promotes oligodendrocyte precursor differentiation and survival.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19350606 2009 Synthesis, structural analysis, and biological evaluation of thioxoquinazoline derivatives as phosphodiesterase 7 inhibitors.
18420479 2008 Effects of phosphodiesterase 7 inhibition by RNA interference on the gene expression and differentiation of human mesenchymal stem cell-derived osteoblasts.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...