Property Summary

NCBI Gene PubMed Count 17
PubMed Score 38.30
PubTator Score 11.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.114 5.9e-03
astrocytoma -1.600 9.1e-03
Breast cancer 1.100 3.9e-04
chronic rhinosinusitis -1.067 1.4e-02
glioblastoma -1.500 6.2e-04
group 4 medulloblastoma -1.200 2.9e-04
intraductal papillary-mucinous adenoma (... 1.100 2.8e-02
intraductal papillary-mucinous carcinoma... 1.200 4.0e-02
lung adenocarcinoma -1.100 1.0e-07
lung cancer -1.400 5.9e-05
medulloblastoma, large-cell -1.100 1.1e-03
ovarian cancer -1.200 2.0e-03
pancreatic ductal adenocarcinoma liver m... -1.724 8.8e-03
Pick disease -1.300 9.2e-05
progressive supranuclear palsy -1.200 1.2e-02
spina bifida -1.940 3.6e-02

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQR      1 - 70
SDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQS     71 - 140
DGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWD    141 - 210
NLNHLNQFVDHEKIYRM                                                         211 - 227
//

Text Mined References (22)

PMID Year Title