Property Summary

NCBI Gene PubMed Count 19
PubMed Score 69.32
PubTator Score 29.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (9)

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY      1 - 70
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK     71 - 140
S//

Text Mined References (24)

PMID Year Title