Property Summary

NCBI Gene PubMed Count 19
PubMed Score 63.83
PubTator Score 29.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q13901 A8K336 D6W5F8 Q05D64 hC1D
Symbols LRP1
hC1D
Rrp47
SUNCOR
SUN-CoR

Gene

C1D

Gene RIF (9)

PMID Text
23333304 HIV-1 Vif modulates the expression of C1D nuclear receptor corepressor (C1D) in Vif-expression T cells
20530579 C1D is associated with the DNA repair complex and may promote repair of ultraviolet irradiation-induced DNA damage.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
17599775 Anti-C1D autoantibodies were observed in patients with polymyositis-scleroderma overlap syndrome.
17412707 Results are consistent with a role for the exosome-associated protein C1D in the recruitment of the exosome to pre-rRNA to mediate the 3' end processing of the 5.8S rRNA.
11801738 TRAX enhances the DNA binding capacity of Translin, that binds to recombination regions in some malignancies. C1D interacts with TRAX following g-irradiation and prevents formation of TRAX/Translin complex, thereby inhibits any unwanted recombination.
9679063 The C1D protein interacts with the catalytic subunit of DNA-PK and is a very effective substrate for DNA-PK in vitro. Moreover, C1D directs the activation of DNA-PK in a manner that does not require DNA termini, suggesting a role for C1D in DNA repair.

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY      1 - 70
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK     71 - 140
S//

Text Mined References (23)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
20530579 2010 XPB induces C1D expression to counteract UV-induced apoptosis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17599775 2007 C1D is a major autoantibody target in patients with the polymyositis-scleroderma overlap syndrome.
17412707 2007 C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...