Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.65
PubTator Score 16.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.500 9.2e-05
lung adenocarcinoma 1.200 8.7e-08
lung cancer 1.100 1.7e-02
malignant mesothelioma 1.100 2.5e-05
non-small cell lung cancer 1.218 2.3e-15
psoriasis 1.100 6.6e-03

 GO Function (1)

Gene RIF (4)

AA Sequence

MPKFKAARGVGGQEKHAPLADQILAGNAVRAGVREKRRGRGTGEAEEEYVGPRLSRRILQQARQQQEELE      1 - 70
AEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKN     71 - 140
PPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPAL    141 - 210
SNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL    211 - 280
FKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKY    281 - 350
ALPYRVLDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRE    351 - 420
LQSAVPRDVEDVPITVE                                                         421 - 437
//

Text Mined References (36)

PMID Year Title