Property Summary

NCBI Gene PubMed Count 44
PubMed Score 6.02
PubTator Score 40.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q13889 B2R819 B4DNZ6 Q7L0G0 Q96AT7
Symbols P34
BTF2
TFB4
TFIIH

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IVW  

Gene RIF (29)

PMID Text
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10438593 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10082552 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10066804 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9765201 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
More...

AA Sequence

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFL      1 - 70
YPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKA     71 - 140
LCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT    141 - 210
GGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP    211 - 280
ICTTCETAFKISLPPVLKAKKKKLKVSA                                              281 - 308
//

Text Mined References (46)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25416956 2014 A proteome-scale map of the human interactome network.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...