Property Summary

NCBI Gene PubMed Count 45
PubMed Score 7.21
PubTator Score 40.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.044 1.7e-02
atypical teratoid/rhabdoid tumor 1.100 5.4e-03
ependymoma 1.100 5.1e-04
glioblastoma 1.200 2.4e-05
intraductal papillary-mucinous carcinoma... 1.200 2.3e-02
nasopharyngeal carcinoma 1.200 5.3e-04
osteosarcoma 2.804 2.9e-09
ovarian cancer 1.100 2.0e-02
pancreatic ductal adenocarcinoma liver m... 1.974 4.6e-03
pediatric high grade glioma 1.400 1.6e-04
Pick disease 1.200 4.2e-07
psoriasis 1.200 3.1e-03

Protein-protein Interaction (4)

Gene RIF (19)

AA Sequence

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFL      1 - 70
YPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKA     71 - 140
LCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT    141 - 210
GGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP    211 - 280
ICTTCETAFKISLPPVLKAKKKKLKVSA                                              281 - 308
//

Text Mined References (47)

PMID Year Title