Property Summary

NCBI Gene PubMed Count 44
PubMed Score 6.02
PubTator Score 40.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.200 3.1e-03
osteosarcoma 2.804 2.9e-09
ependymoma 1.100 5.1e-04
glioblastoma 1.200 2.4e-05
pancreatic ductal adenocarcinoma liver m... 1.974 4.6e-03
intraductal papillary-mucinous carcinoma... 1.200 2.3e-02
pediatric high grade glioma 1.400 1.6e-04
atypical teratoid/rhabdoid tumor 1.100 5.4e-03
aldosterone-producing adenoma -1.044 1.7e-02
nasopharyngeal carcinoma 1.200 5.3e-04
Pick disease 1.200 4.2e-07
ovarian cancer 1.100 2.0e-02

Gene RIF (18)

PMID Text
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10438593 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10082552 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10066804 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9765201 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9651670 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9570510 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9334327 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9311822 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9184228 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9121429 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9054383 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8934526 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8849451 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8628270 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter

AA Sequence

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFL      1 - 70
YPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKA     71 - 140
LCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT    141 - 210
GGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP    211 - 280
ICTTCETAFKISLPPVLKAKKKKLKVSA                                              281 - 308
//

Text Mined References (46)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25416956 2014 A proteome-scale map of the human interactome network.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10673506 2000 Nucleotide excision repair of DNA with recombinant human proteins: definition of the minimal set of factors, active forms of TFIIH, and modulation by CAK.
10583946 1999 Quality control by DNA repair.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8652557 1996 Interactions involving the human RNA polymerase II transcription/nucleotide excision repair complex TFIIH, the nucleotide excision repair protein XPG, and Cockayne syndrome group B (CSB) protein.
8628270 1996 Three functional classes of transcriptional activation domain.
8465201 1993 DNA repair helicase: a component of BTF2 (TFIIH) basic transcription factor.
8194529 1994 p44 and p34 subunits of the BTF2/TFIIH transcription factor have homologies with SSL1, a yeast protein involved in DNA repair.
7724549 1995 The 62- and 80-kDa subunits of transcription factor IIH mediate the interaction with Epstein-Barr virus nuclear protein 2.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1939143 1991 Purification and interaction properties of the human RNA polymerase B(II) general transcription factor BTF2.