Property Summary

NCBI Gene PubMed Count 61
PubMed Score 6.84
PubTator Score 104.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q13888 Q15570 Q15571 Q9BS41
Symbols p44
BTF2
TFIIH
BTF2P44
T-BTF2P44

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IVW   1Z60  

 MGI Term (1)

Gene RIF (38)

PMID Text
25801217 Advanced oxidation protein products down-regulate the expression of calcium transport channels through p44/42 MAPK signaling mechanisms in the small intestinal epithelium.
24944016 Together, these results suggest that p44/WDR77 expression causes the non-sensitivity of proliferating cells to TGFbeta signaling, thereby contributing to cellular proliferation during lung tumorigenesis.
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
21821450 No correlation was found for p44 and occludin gene copy number and spinal muscular atrophy
21558443 miR-27a was identified as a key regulator of p44 mRNA. Moreover, miR-27a was shown to destabilize the p44 subunit of the TFIIH complex during the G2-M phase, thereby modulating the transcriptional shutdown observed during this transition.
19154529 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of general transcription factor IIH, polypeptide 2 (GTF2H2, 44kDa) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17332483 Impaired transcription in IPF is associated with decreased concentrations of transcription factor II-H in alveolar macrophages and may alter the intraalveolar milieu in IPF.
15790571 solution structure of p44-(321-395) shows topology differs from other reported RING domains by a circular permutation of the extended secondary structure elements; mutagenesis suggests tight binding to p34 is mediated by hydrophobic interactions
14980221 p44 of TFIIH has a role in binding to the nonstructural protein of Rift Valley fever virus to form nuclear filamentous structures
More...

AA Sequence

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT      1 - 70
MEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCH     71 - 140
GEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTV    141 - 210
LARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNT    211 - 280
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG    281 - 350
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV                             351 - 395
//

Text Mined References (63)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25801217 2015 Advanced oxidation protein products decrease the expression of calcium transport channels in small intestinal epithelium via the p44/42 MAPK signaling pathway.
24944016 2014 P44/WDR77 restricts the sensitivity of proliferating cells to TGF? signaling.
21821450 2012 Correlation of SMN2, NAIP, p44, H4F5 and Occludin genes copy number with spinal muscular atrophy phenotype in Tunisian patients.
21558443 2011 MicroRNA-27a regulates basal transcription by targeting the p44 subunit of general transcription factor IIH.
21269460 2011 Initial characterization of the human central proteome.
19154529 2009 A population-based study of genotypic and phenotypic variability in children with spinal muscular atrophy.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
17332483 2007 Impairment of alveolar macrophage transcription in idiopathic pulmonary fibrosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...