Property Summary

NCBI Gene PubMed Count 139
PubMed Score 207.96
PubTator Score 139.18

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (109)

AA Sequence

MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQP      1 - 70
AQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFL     71 - 140
PDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQ    141 - 210
ELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQG    211 - 280
MPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVN    281 - 350
SQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL    351 - 420
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN                                     421 - 457
//

Text Mined References (143)

PMID Year Title