Property Summary

NCBI Gene PubMed Count 136
Grant Count 99
R01 Count 75
Funding $9,436,150.69
PubMed Score 189.70
PubTator Score 139.18

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13887 A2TJX0 L0R3U5 L0R4T9 Q9UHP8
Symbols CKLF
IKLF
BTEB2

Gene

PDB

2EBT  

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1700 screening 672 / 0 / 290221 Primary cell-based high throughput screening assay to identify inhibitors of kruppel-like factor 5 (KLF5)
1834 screening 484 / 0 / 126 Luminescence-based confirmation cell-based high throughput screening assay to identify inhibitors of kruppel-like factor 5 (KLF5)
1858 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of kruppel-like factor 5 (KLF5)
1973 confirmatory 119 / 0 / 3 Luminescence-based dose response cell-based high throughput screening assay for inhibitors of kruppel-like factor 5 (KLF5).
2750 confirmatory 24 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5
434957 confirmatory 13 / 0 / 24 Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5 (Round 1)
485336 confirmatory 2 / 0 / 5 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels
588539 other 3 / 0 / 0 Late stage assay provider counterscreen results for the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Cell cycle analysis of the DLD-1 cell line
588617 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels in DLD1 cells
588652 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels in HCT116 human colorectal carcinoma cells
More...

Gene RIF (106)

PMID Text
26792671 We provide the first evidence that the expression of KLF5 is up-regulated in small airways and pulmonary vessels of patients with COPD and may be involved in the tissue remodeling of COPD.
26786295 Data suggest both KLF5 and FYN (FYN proto-oncogene) are important in regulation of migration in bladder cancer cells; KLF5 up-regulates cell migration, lamellipodia formation, expression of FYN, and phosphorylation of FAK (focal adhesion kinase).
26544730 our results indicate that KLF5 promotes angiogenesis of bladder cancer through directly regulating VEGFA transcription
26483416 that estrogen biphasically modulates prostate tumor formation by regulating Kruppel-like zinc finger transcription factor 5-dependent transcription through estrogen receptor beta
26474386 Data indicate direct binding of microRNA miR-375 to the 3'-untranslated region of transcription factor KLF5.
26419610 BAP1 interacts directly with KLF5 and stabilizes KLF5 via deubiquitination.
26397390 ABL-N administration induced apoptosis of PC3 cells in a dose-dependent manner, along with the enhanced activity of caspases and increased Bax/Bcl-2 ratio. Expression of KLF5, Stat5b and ICAM-1 was significantly downregulated in PC3 cells.
26189798 findings collectively suggest that TNFAIP2 is a direct KLF5 target gene, and both KLF5 and TNFAIP2 promote breast cancer cell proliferation, migration and invasion through Rac1 and Cdc42
26097551 down-regulation of KLF4 and up-regulation of KLF5 may stimulate oral carcinoma progression through the dedifferentiation of carcinoma cells.
26079537 ATXN3L has a role in the regulation of KLF5 stability in breast cancer
More...

AA Sequence

MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQP      1 - 70
AQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFL     71 - 140
PDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQ    141 - 210
ELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQG    211 - 280
MPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVN    281 - 350
SQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL    351 - 420
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN                                     421 - 457
//

Text Mined References (139)

PMID Year Title
26792671 2016 Possible role of Krüppel-like factor 5 in the remodeling of small airways and pulmonary vessels in chronic obstructive pulmonary disease.
26786295 2016 KLF5 promotes cell migration by up-regulating FYN in bladder cancer cells.
26544730 2015 Beyond proliferation: KLF5 promotes angiogenesis of bladder cancer through directly regulating VEGFA transcription.
26483416 2016 Estrogen Exhibits a Biphasic Effect on Prostate Tumor Growth through the Estrogen Receptor ?-KLF5 Pathway.
26474386 2015 Potential involvement of miR-375 in the premalignant progression of oral squamous cell carcinoma mediated via transcription factor KLF5.
26419610 2015 BAP1 promotes breast cancer cell proliferation and metastasis by deubiquitinating KLF5.
26397390 2015 ABL-N may induce apoptosis of human prostate cancer cells through suppression of KLF5, ICAM-1 and Stat5b, and upregulation of Bax/Bcl-2 ratio: An in vitro and in vivo study.
26189798 2016 KLF5 promotes breast cancer proliferation, migration and invasion in part by upregulating the transcription of TNFAIP2.
26097551 2015 Krüppel-like factors 4 and 5 expression and their involvement in differentiation of oral carcinomas.
26079537 2015 Ataxin-3 like (ATXN3L), a member of the Josephin family of deubiquitinating enzymes, promotes breast cancer proliferation by deubiquitinating Krüppel-like factor 5 (KLF5).
More...