Property Summary

NCBI Gene PubMed Count 43
Grant Count 41
R01 Count 30
Funding $3,507,846.36
PubMed Score 88.79
PubTator Score 59.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
26045791 Suggest role for miR-570/KLF9 molecular network in controlling lung carcinoma progression.
25686501 Palmitic acid increases Ppargamma and Klf6 & Klf9 gene expression and promotes triglyceride accumulation in HepG2 cells.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25641762 The expression of KLF9 is down-regulated in esophageal squamous cell carcinoma and inversely correlated with the clinical features.
25330987 TRs cooperate with KLF9 to regulate hepatocyte proliferation and differentiation and early stages of organogenesis and that TRs exert widespread and important influences on ESC biology.
25313913 Myometrial KLF9 may contribute to the onset of human parturition through its regulation of PGR expression and inflammatory signaling networks.
25305446 Reduced KLF9 expression is associated with glioma.
25288800 Data indicate that integrin alpha6 repression by Kruppel-like factor-9 (KLF9) inhibits glioblastoma cell stemness and tumorigenicity.
25242357 KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression by increasing protein stability.
25217496 increased KLF9 expression is in part responsible for CYP2D6 induction during pregnancy via the potentiation of HNF4alpha transactivation of CYP2D6.
More...

AA Sequence

MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDL      1 - 70
NKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASE     71 - 140
KRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEK    141 - 210
RFMRSDHLTKHARRHTEFHPSMIKRSKKALANAL                                        211 - 244
//

Text Mined References (46)

PMID Year Title
26045791 2015 MicroRNA-570 promotes lung carcinoma proliferation through targeting tumor suppressor KLF9.
25686501 2015 The activation of peroxisome proliferator-activated receptor ? is regulated by Krüppel-like transcription factors 6 & 9 under steatotic conditions.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25641762 2016 Krüppel-like factor 9 was down-regulated in esophageal squamous cell carcinoma and negatively regulated beta-catenin/TCF signaling.
25330987 2015 A thyroid hormone receptor/KLF9 axis in human hepatocytes and pluripotent stem cells.
25313913 2015 Prolonged pregnancy in women is associated with attenuated myometrial expression of progesterone receptor co-regulator Krüppel-like Factor 9.
25305446 2015 Krüppel-like factor 9 inhibits glioma cell proliferation and tumorigenicity via downregulation of miR-21.
25288800 2014 Kruppel-like factor-9 (KLF9) inhibits glioblastoma stemness through global transcription repression and integrin ?6 inhibition.
25242357 2014 Transcription factor KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression.
25217496 2014 Krüppel-like factor 9 promotes hepatic cytochrome P450 2D6 expression during pregnancy in CYP2D6-humanized mice.
More...