Property Summary

NCBI Gene PubMed Count 43
PubMed Score 88.79
PubTator Score 59.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 3.13276033672048E-18
non-small cell lung cancer 2798 1.23521637863136E-16
ovarian cancer 8492 7.87359559489067E-10
lung cancer 4473 2.50708370676943E-6
malignant mesothelioma 3163 9.05975978529476E-6
breast carcinoma 1614 9.60703417595457E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.17143248434374E-4
psoriasis 6685 4.00837506888202E-4
ductal carcinoma in situ 1745 5.63404767089744E-4
tuberculosis and treatment for 6 months 686 0.00112602724073438
colon cancer 1475 0.00196759732269881
Pick disease 1893 0.002128707031502
pituitary cancer 1972 0.00225285182689076
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0025280661980719
Rheumatoid Arthritis 1171 0.00292415443272336
non-inflammatory breast cancer 208 0.00359146056188013
interstitial lung disease 292 0.0054287919552095
group 3 medulloblastoma 2254 0.00603113412231941
subependymal giant cell astrocytoma 2287 0.0073658794914898
invasive ductal carcinoma 2950 0.00759334546280837
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00956602840896703
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00965756836910821
acute quadriplegic myopathy 1157 0.011147243039512
Atopic dermatitis 944 0.0121255599773073
atypical teratoid / rhabdoid tumor 4369 0.015468803139341
primitive neuroectodermal tumor 3031 0.0164357629876607
medulloblastoma, large-cell 6234 0.0184482726303215
chronic rhinosinusitis 512 0.0278104357230371
ependymoma 2514 0.0443914570019705
cystic fibrosis and chronic rhinosinusitis 213 0.0487555698467164
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

Synonym

Accession Q13886 B2R943 Q16196
Symbols BTEB
BTEB1

Gene

  Ortholog (11)

Gene RIF (32)

PMID Text
26045791 Suggest role for miR-570/KLF9 molecular network in controlling lung carcinoma progression.
25686501 Palmitic acid increases Ppargamma and Klf6 & Klf9 gene expression and promotes triglyceride accumulation in HepG2 cells.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25641762 The expression of KLF9 is down-regulated in esophageal squamous cell carcinoma and inversely correlated with the clinical features.
25330987 TRs cooperate with KLF9 to regulate hepatocyte proliferation and differentiation and early stages of organogenesis and that TRs exert widespread and important influences on ESC biology.
25313913 Myometrial KLF9 may contribute to the onset of human parturition through its regulation of PGR expression and inflammatory signaling networks.
25305446 Reduced KLF9 expression is associated with glioma.
25288800 Data indicate that integrin alpha6 repression by Kruppel-like factor-9 (KLF9) inhibits glioblastoma cell stemness and tumorigenicity.
25242357 KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression by increasing protein stability.
25217496 increased KLF9 expression is in part responsible for CYP2D6 induction during pregnancy via the potentiation of HNF4alpha transactivation of CYP2D6.
More...

AA Sequence

MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDL      1 - 70
NKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASE     71 - 140
KRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEK    141 - 210
RFMRSDHLTKHARRHTEFHPSMIKRSKKALANAL                                        211 - 244
//

Text Mined References (46)

PMID Year Title
26045791 2015 MicroRNA-570 promotes lung carcinoma proliferation through targeting tumor suppressor KLF9.
25686501 2015 The activation of peroxisome proliferator-activated receptor ? is regulated by Krüppel-like transcription factors 6 & 9 under steatotic conditions.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25641762 2016 Krüppel-like factor 9 was down-regulated in esophageal squamous cell carcinoma and negatively regulated beta-catenin/TCF signaling.
25330987 2015 A thyroid hormone receptor/KLF9 axis in human hepatocytes and pluripotent stem cells.
25313913 2015 Prolonged pregnancy in women is associated with attenuated myometrial expression of progesterone receptor co-regulator Krüppel-like Factor 9.
25305446 2015 Krüppel-like factor 9 inhibits glioma cell proliferation and tumorigenicity via downregulation of miR-21.
25288800 2014 Kruppel-like factor-9 (KLF9) inhibits glioblastoma stemness through global transcription repression and integrin ?6 inhibition.
25242357 2014 Transcription factor KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression.
25217496 2014 Krüppel-like factor 9 promotes hepatic cytochrome P450 2D6 expression during pregnancy in CYP2D6-humanized mice.
More...