Property Summary

NCBI Gene PubMed Count 47
PubMed Score 99.87
PubTator Score 59.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Gene RIF (36)

AA Sequence

MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDL      1 - 70
NKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASE     71 - 140
KRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEK    141 - 210
RFMRSDHLTKHARRHTEFHPSMIKRSKKALANAL                                        211 - 244
//

Text Mined References (50)

PMID Year Title