Property Summary

NCBI Gene PubMed Count 78
PubMed Score 38.95
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 2.220 4.7e-02
acute quadriplegic myopathy 1.219 8.5e-03
Amyotrophic lateral sclerosis 1.300 7.2e-04
astrocytic glioma -1.900 7.9e-03
Astrocytoma, Pilocytic -1.100 8.3e-07
atypical teratoid / rhabdoid tumor -1.600 1.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.834 6.2e-03
Becker muscular dystrophy 1.731 9.6e-03
dermatomyositis 2.000 1.6e-03
Duchenne muscular dystrophy 2.219 1.1e-07
ependymoma -1.500 3.6e-02
fascioscapulohumeral muscular dystrophy 1.407 4.7e-04
gastric cancer -1.300 9.0e-03
hepatocellular carcinoma -2.100 2.0e-06
interstitial cystitis 1.200 1.9e-03
juvenile dermatomyositis 2.093 9.8e-11
limb girdle muscular dystrophy 2A 1.381 6.6e-04
medulloblastoma, large-cell -1.800 3.7e-05
nasopharyngeal carcinoma -1.700 3.5e-03
oligodendroglioma -1.400 3.4e-02
ovarian cancer -1.700 4.2e-03
pancreatic cancer -1.900 6.6e-03
pancreatic carcinoma -1.900 6.6e-03
Pick disease -1.300 1.2e-02
psoriasis 1.600 9.6e-04

Protein-protein Interaction (11)

Gene RIF (20)

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (84)

PMID Year Title