Property Summary

Ligand Count 11
NCBI Gene PubMed Count 78
PubMed Score 38.95
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 2.220 4.7e-02
acute quadriplegic myopathy 1.219 8.5e-03
Amyotrophic lateral sclerosis 1.300 7.2e-04
astrocytic glioma -1.900 7.9e-03
Astrocytoma, Pilocytic -1.100 8.3e-07
atypical teratoid / rhabdoid tumor -1.600 1.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.834 6.2e-03
Becker muscular dystrophy 1.731 9.6e-03
dermatomyositis 2.000 1.6e-03
Duchenne muscular dystrophy 2.219 1.1e-07
ependymoma -1.500 3.6e-02
fascioscapulohumeral muscular dystrophy 1.407 4.7e-04
gastric cancer -1.300 9.0e-03
hepatocellular carcinoma -2.100 2.0e-06
interstitial cystitis 1.200 1.9e-03
juvenile dermatomyositis 2.093 9.8e-11
limb girdle muscular dystrophy 2A 1.381 6.6e-04
medulloblastoma, large-cell -1.800 3.7e-05
nasopharyngeal carcinoma -1.700 3.5e-03
oligodendroglioma -1.400 3.4e-02
ovarian cancer -1.700 4.2e-03
pancreatic cancer -1.900 6.6e-03
pancreatic carcinoma -1.900 6.6e-03
Pick disease -1.300 1.2e-02
psoriasis 1.600 9.6e-04

Protein-protein Interaction (11)

Gene RIF (20)

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (84)

PMID Year Title