Property Summary

NCBI Gene PubMed Count 78
PubMed Score 36.07
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (60)

Disease Z-score Confidence
Acute lymphoid leukemia 25
Amyotrophic Lateral Sclerosis 431
Anaplastic large T-cell systemic maligna... 10 
Becker muscular dystrophy 187
Burkitt's lymphoma 15
CORTICAL DYSPLASIA, COMPLEX, WITH OTHER ... 1 
Carcinoma of breast 11
Carcinoma of female breast 20
Creutzfeldt-Jakob disease 19
Diffuse non-Hodgkin's lymphoma, large ce... 12 
Duchenne muscular dystrophy 602
Follicular non-Hodgkin's lymphoma 17
Gestational trophoblastic neoplasia 14
HER2-positive carcinoma of breast 10
Hodgkin's disease 18
Hypertensive disorder 58
Juvenile arthritis 124
Kaposi's sarcoma 20
Langerhans cell histiocytosis, dissemina... 10 
Leukemia, Myelocytic, Acute 113
Liposarcoma 20
Malignant tumor of head and/or neck 15
Malignant tumor of ovary 25
Malignant tumor of prostate 11
Malignant tumor of stomach 12
Malignant tumor of testis 11
Metastatic Breast Carcinoma 21
Metastatic Prostate Carcinoma 18
Mycosis fungoides 28
Nephroblastoma 45
Neuroblastoma 78
Non-Hodgkin's lymphoma 22
Ocular hypertension 27
Open-angle glaucoma 26
Pick disease 1,893
Rhabdomyosarcoma 29
Secondary malignant neoplasm of pancreas 10
Transitional cell carcinoma 18
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
dermatomyositis 933
ependymoma 2,514
fascioscapulohumeral muscular dystrophy 100
gastric cancer 430
hepatocellular carcinoma 532
interstitial cystitis 2,299
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
psoriasis 6,685

Expression

Synonym

Accession Q13885 Q6FGZ8 Q8IWR2
Symbols TUBB
TUBB2
CDCBM5

Gene

 GO Process (1)

Gene RIF (21)

PMID Text
24702957 study associates mutations in TUBB2A with the spectrum of "tubulinopathy" phenotypes
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22718863 This is the first study showing that paclitaxel neuropathy risk is influenced by polymorphisms regulating the expression of a beta-tubulin gene.
22449234 Class II beta-tubulin may be very useful for immunohistochemical diagnosis of classical Hodgkin's lymphoma.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22180309 Data suggest that the increased betaII- and betaIII-tubulin contributed significantly to the resistance phenotype.
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19454010 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
More...

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (84)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24702957 2014 De novo mutations in the beta-tubulin gene TUBB2A cause simplified gyral patterning and infantile-onset epilepsy.
22718863 2012 Regulatory polymorphisms in ?-tubulin IIa are associated with paclitaxel-induced peripheral neuropathy.
22449234 2012 Expression of ?-tubulin isotypes in classical Hodgkin's lymphoma.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22180309 2012 ?II-tubulin and ?III-tubulin mediate sensitivity to peloruside A and laulimalide, but not paclitaxel or vinblastine, in human ovarian carcinoma cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
More...