Property Summary

NCBI Gene PubMed Count 78
PubMed Score 36.07
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 9.771607838237E-11
Duchenne muscular dystrophy 602 1.12962158163654E-7
pilocytic astrocytoma 3086 8.42100944904412E-7
hepatocellular carcinoma 550 2.01355436938423E-6
medulloblastoma, large-cell 6234 3.66655627967409E-5
ovarian cancer 8492 4.91279910435539E-5
fascioscapulohumeral muscular dystrophy 100 4.70732637641137E-4
Amyotrophic Lateral Sclerosis 432 7.23394819302009E-4
psoriasis 6685 9.64759347545221E-4
dermatomyositis 967 0.00160886936215966
interstitial cystitis 2299 0.00192165312344329
limb girdle muscular dystrophy 2B 74 0.00244084455512709
nasopharyngeal carcinoma 1056 0.00346622201187847
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00616631518892152
pancreatic carcinoma 567 0.00658981097889247
pancreatic cancer 2300 0.00658981097889248
astrocytic glioma 2241 0.00786805348295167
acute quadriplegic myopathy 1157 0.00853855085142978
gastric cancer 436 0.00900638099518621
Becker muscular dystrophy 187 0.00960637965449504
atypical teratoid / rhabdoid tumor 4369 0.0111921159206929
Pick disease 1893 0.0120402333808932
oligodendroglioma 2849 0.0343480846085253
ependymoma 2514 0.0355026434137582
active ulcerative colitis 477 0.0467434213302118

Expression

Synonym

Accession Q13885 Q6FGZ8 Q8IWR2
Symbols TUBB
TUBB2
CDCBM5

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Zebrafish OMA EggNOG

 GO Process (1)

Gene RIF (20)

PMID Text
24702957 study associates mutations in TUBB2A with the spectrum of "tubulinopathy" phenotypes
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22718863 This is the first study showing that paclitaxel neuropathy risk is influenced by polymorphisms regulating the expression of a beta-tubulin gene.
22449234 Class II beta-tubulin may be very useful for immunohistochemical diagnosis of classical Hodgkin's lymphoma.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22180309 Data suggest that the increased betaII- and betaIII-tubulin contributed significantly to the resistance phenotype.
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19454010 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
More...

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (84)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24702957 2014 De novo mutations in the beta-tubulin gene TUBB2A cause simplified gyral patterning and infantile-onset epilepsy.
22718863 2012 Regulatory polymorphisms in ?-tubulin IIa are associated with paclitaxel-induced peripheral neuropathy.
22449234 2012 Expression of ?-tubulin isotypes in classical Hodgkin's lymphoma.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22180309 2012 ?II-tubulin and ?III-tubulin mediate sensitivity to peloruside A and laulimalide, but not paclitaxel or vinblastine, in human ovarian carcinoma cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
More...