Property Summary

NCBI Gene PubMed Count 92
Grant Count 69
R01 Count 54
Funding $5,450,095.09
PubMed Score 167.06
PubTator Score 107.85

Knowledge Summary

Patent (16,143)

Expression

Synonym

Accession Q13882 B2RCR3 B4DW46 Q58F01
Symbols BRK

Gene

PDB

1RJA   2KGT   5D7V   5DA3  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (65)

PMID Text
26825173 PELP1 interacted with GR to activate Brk expression.
26013168 PTK6 prolongs S-phase and increases the ability of gemcitabine to cause DNA damage in vitro and in vivo
25940761 Activating mutations in BRK in breast cancer may disrupt intramolecular interactions that normally maintain BRK in an autoinhibited conformation.
25897081 PTP1B inhibited BRK by dephosphorylating Tyr-342, but activated SRC by antagonizing PAG-dependent inhibition by CSK.
25838168 Establishment of cross talk between PTK6 and CagA by functional studies may further elucidate the underlying biology of H. pylori-mediated gastric cancer
25770659 BRK expression in a majority of CC can interact with RTK, augmenting growth and interfering with proliferation inhibitors (SAM68). Therapeutically targeting BRK function (in addition to RTK) should be of benefit for CC treatment.
25748447 overexpression or knockdown of PTK6 or ERK1/2 effectively removed the inhibition of S1P-induced migration by miR-17.
25733683 This study shows that Brk phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.
25377660 Down-regulated expression of PTK6 is correlated with poor survival in esophageal squamous cell carcinoma.
25241146 Additive impact of HER2-/PTK6-RNAi on interactions with HER3 or IGF-1R leads to reduced breast cancer progression
More...

AA Sequence

MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAER      1 - 70
ETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLN     71 - 140
EAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLW    141 - 210
KDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSD    211 - 280
EKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP    281 - 350
YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM    351 - 420
LTCWCRDPEQRPCFKALRERLSSFTSYENPT                                           421 - 451
//

Text Mined References (101)

PMID Year Title
27480927 2016 Crystal structure of the kinase domain of human protein tyrosine kinase 6 (PTK6) at 2.33 ? resolution.
26825173 2016 Breast Tumor Kinase (Brk/PTK6) Is Induced by HIF, Glucocorticoid Receptor, and PELP1-Mediated Stress Signaling in Triple-Negative Breast Cancer.
26751287 2016 The LINK-A lncRNA activates normoxic HIF1? signalling in triple-negative breast cancer.
26013168 2015 PTK6 Potentiates Gemcitabine-Induced Apoptosis by Prolonging S-phase and Enhancing DNA Damage in Pancreatic Cancer.
25940761 2015 Cancer-Associated Mutations in Breast Tumor Kinase/PTK6 Differentially Affect Enzyme Activity and Substrate Recognition.
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
25838168 2015 Signature of positive selection of PTK6 gene in East Asian populations: a cross talk for Helicobacter pylori invasion and gastric cancer endemicity.
25770659 2015 Breast tumor kinase/protein tyrosine kinase 6 (Brk/PTK6) activity in normal and neoplastic biliary epithelia.
25748447 2015 Sphingosine-1-phosphate induces the migration of thyroid follicular carcinoma cells through the microRNA-17/PTK6/ERK1/2 pathway.
25733683 2015 Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.
More...