Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.41
PubTator Score 14.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
progressive supranuclear palsy -1.500 2.3e-02
active Crohn's disease -1.059 3.0e-02
active ulcerative colitis -1.219 2.4e-02
adult high grade glioma -3.000 4.9e-03
astrocytic glioma -2.700 4.9e-02
Astrocytoma, Pilocytic -4.100 1.2e-07
atypical teratoid / rhabdoid tumor -2.900 5.8e-07
Down syndrome 1.100 2.5e-02
ependymoma -3.700 8.9e-03
glioblastoma -3.100 1.3e-05
group 3 medulloblastoma -4.300 9.2e-04
medulloblastoma, large-cell -3.100 3.9e-04
non primary Sjogren syndrome sicca -1.100 2.0e-02
oligodendroglioma -2.200 5.5e-07
ovarian cancer 1.100 8.8e-10
primitive neuroectodermal tumor -2.600 1.2e-02
subependymal giant cell astrocytoma -6.082 1.9e-03

Gene RIF (7)

AA Sequence

MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRT      1 - 70
SRRAKSPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRSERQPRSPPRSERQPRPR     71 - 140
PEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKASRFW                               141 - 183
//

Text Mined References (22)

PMID Year Title