Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 2
Funding $461,740.76
PubMed Score 21.88
PubTator Score 14.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26077951 rs1768208 is associated with corticobasal degeneration.
24994843 The rs1768208 risk polymorphism in MOBP has prognostic value in behavioral-variant frontotemporal dementia.
23116876 Genotypes at MOBP and EIF2AK3 confer risk predominantly in APOE epsilon4-positive subjects, with indications of an interaction between APOE and MOBP or EIF2AK3 on Alzheimer's disease risk.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17964117 MOBP mRNA levels were increased in the DLPFC white matter in patients with a history of substance abuse.
15009677 Decreased expression of a number of myelin-related genes, including myelin basic protein (MBP), proteolipid protein (PLP), and myelin-associated oligodendrocyte basic protein (MOBP) was noted in nucleus accumbens of cocaine abusers

AA Sequence

MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRT      1 - 70
SRRAKSPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRSERQPRSPPRSERQPRPR     71 - 140
PEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKASRFW                               141 - 183
//

Text Mined References (21)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26077951 2015 Genome-wide association study of corticobasal degeneration identifies risk variants shared with progressive supranuclear palsy.
25416956 2014 A proteome-scale map of the human interactome network.
24994843 2014 Myelin oligodendrocyte basic protein and prognosis in behavioral-variant frontotemporal dementia.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23116876 2013 An exploratory study on STX6, MOBP, MAPT, and EIF2AK3 and late-onset Alzheimer's disease.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
More...