Property Summary

NCBI Gene PubMed Count 209
Grant Count 302
R01 Count 167
Funding $44,058,696.89
PubMed Score 415.25
PubTator Score 624.08

Knowledge Summary

Patent (17,055)

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.005
malignant mesothelioma -1.200 0.000
osteosarcoma 4.807 0.000
chronic lymphosyte leukemia 1.600 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.300 0.003
primary pancreatic ductal adenocarcinoma 2.597 0.000
Breast cancer 3.600 0.025
lung adenocarcinoma -1.200 0.000
adult high grade glioma -1.100 0.003
aldosterone-producing adenoma -1.453 0.007
acute myeloid leukemia -1.800 0.024
ovarian cancer 1.900 0.004
pancreatic cancer 2.500 0.000

Synonym

Accession Q13873 Q13161 Q16569 Q4ZG08 Q53SA5 Q585T8 BMP type-2 receptor
Symbols BMR2
PPH1
BMPR3
BRK-3
POVD1
T-ALK
BMPR-II

Gene

PDB

2HLQ   3G2F  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (177)

PMID Text
26772960 establish the feasibility of combining NELL-1 with BMP2 to improve clinical bone regeneration and provide mechanistic insight into canonical Wnt pathway activity during NELL-1 and BMP2 osteogenesis
26739752 the data in the present study support the notion that the expression levels and plasma membrane levels of BMPRII are determined by two molecular processes-translational regulation of protein synthesis (which provides the major contribution) and endocytosis/degradation (mild modulatory effect).
26589479 Raf family members and ERK1/2 were constitutively activated after BMPR2 knockdown
26541523 In a group of pulmonary arterial hypertension patients, 25.4% harboured heterozygous mutation in the BMPR2 gene.
26406943 An up-regulated expression of BMP-4 and BMPR-II was observed in the peripheral blood of breast cancer patients especially in the advanced-stage of the disease. Moreover, BMP-4 and BMPR-II expressions were found to be correlated
26167679 study shows for the first time that in the regulatory region of the BMPR2 gene the promoter may be important for pulmonary arterial hypertension penetrance
26151470 miR-153 is a mechano-sensitive miRNA that regulates osteoblast differentiation by directly targeting BMPR2, and that therapeutic inhibition of miR-153 may be an efficient anabolic strategy for skeletal disorders caused by pathological mechanical loading.
26076038 BMP9 is identified as the preferred ligand for preventing apoptosis and enhancing monolayer integrity in endothelial cells from subjects with pulmonary arterial hypertension who bear mutations in the gene encoding BMPR2.
26030479 Mutations in BMPR2 underlie most heritable cases and a small proportion of sporadic cases of idiopathic pulmonary arterial hypertension. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201408-1528OC#.Viqgi9KFPyA
25755766 our results showed that GDF-5 and BMPRII expressed both in normal and degenerated intervertebral disc tissues, and GDF-5 might have an inhibition effect on degenerated lumbar intervertebral discs
More...

AA Sequence

MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLW      1 - 70
EKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLS     71 - 140
PPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIG    141 - 210
RGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVME    211 - 280
YYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVIS    281 - 350
DFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC    351 - 420
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEA    421 - 490
RLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTD    491 - 560
SIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTIS    561 - 630
EMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLS    631 - 700
STSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPR    701 - 770
LKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT    771 - 840
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPC    841 - 910
SEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKKRVKTPYS    911 - 980
LKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL                981 - 1038
//

Text Mined References (215)

PMID Year Title
27273094 2016 BMP signaling turns up in fragile X syndrome: FMRP represses BMPR2.
26772960 2016 Novel Wnt Regulator NEL-Like Molecule-1 Antagonizes Adipogenesis and Augments Osteogenesis Induced by Bone Morphogenetic Protein 2.
26739752 2016 Differential regulation of translation and endocytosis of alternatively spliced forms of the type II bone morphogenetic protein (BMP) receptor.
26690041 2016 Structural insights into BMP receptors: Specificity, activation and inhibition.
26589479 2016 Raf/ERK drives the proliferative and invasive phenotype of BMPR2-silenced pulmonary artery endothelial cells.
26541523 2015 Occupational exposure to organic solvents: a risk factor for pulmonary veno-occlusive disease.
26406943 2015 Transcriptional up-regulation of BMP-4 and BMPR-II genes in the peripheral blood of breast cancer patients: A pilot study.
26373550 2015 BMPR2 spruces up the endothelium in pulmonary hypertension.
26167679 2015 Mutation in BMPR2 Promoter: A 'Second Hit' for Manifestation of Pulmonary Arterial Hypertension?
26151470 2015 MicroRNA-153 suppresses the osteogenic differentiation of human mesenchymal stem cells by targeting bone morphogenetic protein receptor type II.
More...