Property Summary

Ligand Count 2
NCBI Gene PubMed Count 237
PubMed Score 458.14
PubTator Score 624.08

Knowledge Summary

Patent (17,055)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Gout 104 0.0 1.2
Disease Target Count Z-score Confidence
Pulmonary venoocclusive disease 3 0.0 5.0

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.800 2.4e-02
adult high grade glioma -1.100 3.1e-03
aldosterone-producing adenoma -1.102 3.2e-02
atypical teratoid / rhabdoid tumor -1.200 7.3e-04
Breast cancer 2.100 4.3e-02
chronic lymphosyte leukemia 1.600 3.8e-08
glioblastoma -1.100 2.3e-04
lung adenocarcinoma -1.200 1.4e-10
malignant mesothelioma -1.200 3.2e-05
medulloblastoma, large-cell -1.300 2.7e-03
osteosarcoma 1.237 3.8e-04
ovarian cancer 1.900 4.2e-03
pancreatic cancer 2.500 3.0e-04
primary pancreatic ductal adenocarcinoma 2.597 5.9e-05
Rheumatoid arthritis 1.100 5.5e-03

Gene RIF (202)

AA Sequence

MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLW      1 - 70
EKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLS     71 - 140
PPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIG    141 - 210
RGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVME    211 - 280
YYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVIS    281 - 350
DFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC    351 - 420
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEA    421 - 490
RLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTD    491 - 560
SIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTIS    561 - 630
EMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLS    631 - 700
STSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPR    701 - 770
LKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT    771 - 840
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPC    841 - 910
SEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKKRVKTPYS    911 - 980
LKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL                981 - 1038
//

Text Mined References (244)

PMID Year Title