Property Summary

NCBI Gene PubMed Count 45
PubMed Score 2.13
PubTator Score 19.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 9.4e-06
osteosarcoma 7950 2.8e-05
group 3 medulloblastoma 4104 2.6e-04
lung cancer 4740 3.8e-04
colon cancer 1478 1.6e-02
Rheumatoid arthritis 1191 1.9e-02
Disease Target Count Z-score Confidence
Brachydactyly 156 3.281 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.500 1.6e-02
group 3 medulloblastoma 1.300 2.6e-04
lung cancer 2.800 3.8e-04
malignant mesothelioma 1.100 9.4e-06
osteosarcoma 1.314 2.8e-05
Rheumatoid arthritis -1.100 1.9e-02

Gene RIF (4)

AA Sequence

MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVK      1 - 70
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDL     71 - 140
ISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPE    141 - 210
HKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEI    211 - 280
VMETRQRLLEQEG                                                             281 - 293
//

Text Mined References (53)

PMID Year Title