Property Summary

NCBI Gene PubMed Count 47
PubMed Score 85.44
PubTator Score 71.19

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Protein-protein Interaction (1)

Gene RIF (21)

AA Sequence

MSSSGLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQRAQHVFQHAVPQEGKPITNQKSS      1 - 70
GRCWIFSCLNVMRLPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVDTAQRKEPEDGRLVQFLLMNP     71 - 140
ANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQD    141 - 210
VMMEEIFRVVCICLGNPPETFTWEYRDKDKNYQKIGPITPLEFYREHVKPLFNMEDKICLVNDPRPQHKY    211 - 280
NKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHELVF    281 - 350
GVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVY    351 - 420
EVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALAE                                       421 - 455
//

Text Mined References (49)

PMID Year Title