Property Summary

NCBI Gene PubMed Count 43
PubMed Score 85.31
PubTator Score 71.19

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
lung cancer 4473 5.86923385909518E-5
medulloblastoma, large-cell 6234 3.39023500887225E-4
group 3 medulloblastoma 2254 5.20129635919109E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.91032659978334E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00180464987123736
Atopic dermatitis 944 0.0226962414865709
Disease Target Count Z-score Confidence
Chromosome 17q11.2 deletion syndrome, 1.4Mb 14 3.957 2.0



Accession Q13867 B2R796 Q53F86 Q9UER9 BH
Symbols BH



1CB5   2CB5  

  Ortholog (13)

Gene RIF (19)

25240784 Bleomycin hydrolase downregulation in lesional skin of adult atopic dermatitis patients is independent of filaggrin gene mutations
24615029 We also detected significant association between XRCC1, XRCC3, and BLHX polymorphisms and a high frequency of chromosomal damage
24496069 This study findings suggest that Blmh interacts with diverse cellular processes from energy metabolism and anti-oxidative defenses to cell cycle, cytoskeleton dynamics, and synaptic plasticity essential for normal brain homeostasis.
23708668 The caspase-dependent cleavage of BLH was confirmed by cleavage of partly-purified human bleomycin hydrolase with caspase-3.
22037625 BH may play an important role during the late stage of epidermal differentiation.
21943823 present study suggests that our new method can detect novel genes of interest and that BLMH is a suppressor gene in HCC
21310951 Cysteine proteases bleomycin hydrolase and cathepsin Z mediate N-terminal proteolysis and toxicity of mutant huntingtin.
21190945 BH activity and expression were markedly decreased in AD lesional skin, suggesting a defect of the filaggrin degradation pathway in AD.
20198498 This first report on BLMH carrier status in Tunisia shows o association between carrying the BLMH-G genotype and Alzheimer's disease in epsilon4 negative or positive subjects.
18398146 The homozygous variant G/G of BLMH gene SNP A1450G is associated with reduced survival and higher prevalence of early relapses in TC patients treated with bleomycin-containing chemotherapy.

AA Sequence

EVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALAE                                       421 - 455

Text Mined References (45)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25240784 2014 Bleomycin hydrolase downregulation in lesional skin of adult atopic dermatitis patients is independent of FLG gene mutations.
24615029 2014 Association among XRCC1, XRCC3, and BLHX gene polymorphisms and chromosome instability in lymphocytes from patients with endometriosis and ovarian cancer.
24496069 2014 Hyperhomocysteinemia and bleomycin hydrolase modulate the expression of mouse brain proteins involved in neurodegeneration.
23708668 2013 Cleavage of bleomycin hydrolase by caspase-3 during apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22037625 2012 Expression of bleomycin hydrolase in keratinization disorders.
21943823 2011 Identification of the bleomycin hydrolase gene as a methylated tumor suppressor gene in hepatocellular carcinoma using a novel triple-combination array method.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21310951 2011 Cysteine proteases bleomycin hydrolase and cathepsin Z mediate N-terminal proteolysis and toxicity of mutant huntingtin.