Property Summary

NCBI Gene PubMed Count 80
Grant Count 51
R01 Count 38
Funding $7,088,378.96
PubMed Score 56.98
PubTator Score 65.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene

PDB

1T5I   1T6N   1XTI   1XTJ   1XTK  

Gene RIF (47)

PMID Text
26265379 However, no significant association was observed between the DDX39B -22 G/C polymorphism in the cases and controls. Furthermore, it is clarified that the protective effect of IL-4 -590 is independent from APOE protective genotypes
25038626 The G allele of DDX39B-22C > G was associated with absent or decreased manifestations of vivax malaria and the C allele was a risk factor for disease complications.
24753416 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
22446327 these data identify UAP56 as an important binding partner of Bcr and a novel target for inhibiting vascular smooth muscle cell proliferation.
22071774 We unravel the role of unexplored immunologically important genes, BAT1 and BTNL2, and the haplotypes of the significantly associated SNPs therein, to understand susceptibility to the disease, leprosy and its differential severity.
21859714 Mx proteins exert their antiviral activity against IAV by interfering with the function of the RNA helicases UAP56 and URH49
More...

AA Sequence

MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSE      1 - 70
VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYM     71 - 140
PNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRD    141 - 210
VQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFD    211 - 280
LLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRG    281 - 350
MDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI    351 - 420
SSYIEQTR                                                                  421 - 428
//

Text Mined References (93)

PMID Year Title
26265379 2015 Association Study of IL-4 -590 C/T and DDX39B -22 G/C Polymorphisms with the Risk of Late-Onset Alzheimer's Disease in Iranian Population.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25038626 2014 DDX39B (BAT1), TNF and IL6 gene polymorphisms and association with clinical outcomes of patients with Plasmodium vivax malaria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928037 2012 The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...