Property Summary

NCBI Gene PubMed Count 119
Grant Count 100
R01 Count 62
Funding $8,742,582.73
PubMed Score 432.74
PubTator Score 379.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13822 A8UHA1 E9PHP7 Q13827 Q14555 Q15117 Q9UCQ8 Q9UCR0 Q9UCR1 Q9UCR2 Q9UCR3 Q9UCR4 E-NPP 2
Symbols ATX
NPP2
ATX-X
PDNP2
LysoPLD
AUTOTAXIN
PD-IALPHA

Gene

PDB

4ZG6   4ZG7   4ZG9   4ZGA  

 GWAS Trait (1)

Gene RIF (97)

PMID Text
26727116 Serum ATX correlates with and predicts measures of glucose homeostasis and insulin sensitivity in older humans, suggesting that it may be a potential pathogenic factor and/or diagnostic/therapeutic target for insulin resistance in this population
26391552 Altered expression of ENPP2 is associated with various diseases, such as, inflammation, cancer, fibrosis, rheumatoid arthritis and neural tube defects. (Review)
26313906 ATX was induced in monocytic THP-1 cells by TLR4 ligand lipopolysaccharide (LPS), TLR9 ligand CpG oligonucleotide, and TLR3 ligand poly(I:C), respectively
26224810 Autotaxin is transported in the aortic valve by lipoprotein(a) and is also secreted by valve interstitial cells.
26072274 Data suggest a role for the autotaxin-lysophosphatidic acid axis in toluene diisocyanate toxicity.
26071407 blocking tumor-driven inflammation by ATX inhibition is effective in decreasing tumor growth in breast cancers where the cancer cells express negligible ATX.
26037280 Autotaxin is an inflammatory mediator and therapeutic target in thyroid cancer
25977291 autotaxin (ATX), is an ecto-lysophospholipase D encoded by the human ENNP2 gene
25896349 The results are discussed in terms of ATX regulation in wound healing and cancer.We, therefore, demonstrate the concept that accumulation of LPA in the circulation decreases ATX production
25536867 Elevated serum autotaxin was correlated with hepatic dysfunction in biliary atresia.
More...

AA Sequence

MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAG      1 - 70
PPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKG     71 - 140
ESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKT    141 - 210
FPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVI    211 - 280
PHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHR    281 - 350
CVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH    351 - 420
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVG    421 - 490
YGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTMPEEVTRPNYPGIMYLQ    491 - 560
SDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPL    561 - 630
WTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVT    631 - 700
NMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYS    701 - 770
IITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR    771 - 840
KTSRSYPEILTLKTYLHTYESEI                                                   841 - 863
//

Text Mined References (120)

PMID Year Title
26727116 2015 Serum Autotaxin/ENPP2 correlates with insulin resistance in older humans with obesity.
26391552 2015 Understanding the Multifaceted Role of Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2) and its Altered Behaviour in Human Diseases.
26313906 2015 Type I Interferons Function as Autocrine and Paracrine Factors to Induce Autotaxin in Response to TLR Activation.
26224810 2015 Autotaxin Derived From Lipoprotein(a) and Valve Interstitial Cells Promotes Inflammation and Mineralization of the Aortic Valve.
26072274 2015 Toluene diisocyanate: Induction of the autotaxin-lysophosphatidic acid axis and its association with airways symptoms.
26071407 2015 Tumor-induced inflammation in mammary adipose tissue stimulates a vicious cycle of autotaxin expression and breast cancer progression.
26037280 2015 Autotaxin is an inflammatory mediator and therapeutic target in thyroid cancer.
25977291 2016 Autotaxin, a lysophospholipase D with pleomorphic effects in oncogenesis and cancer progression.
25896349 2015 Regulation of autotaxin expression and secretion by lysophosphatidate and sphingosine 1-phosphate.
25536867 2015 Serum autotaxin levels correlate with hepatic dysfunction and severity in postoperative biliary atresia.
More...