Property Summary

Ligand Count 107
NCBI Gene PubMed Count 135
PubMed Score 463.16
PubTator Score 379.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Thyroid Neoplasm 37
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Obesity 678 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 4.157 2.1
Cholestasis 155 3.505 1.8
Liver disease 237 3.198 1.6

Expression

  Differential Expression (38)

Disease log2 FC p
adult high grade glioma -2.200 6.9e-03
astrocytic glioma -3.000 3.6e-02
Astrocytoma, Pilocytic -2.800 5.8e-07
autosomal dominant Emery-Dreifuss muscul... 1.474 7.3e-03
Breast cancer -2.300 3.5e-02
breast carcinoma -1.900 3.7e-05
Chronic Lymphocytic Leukemia 1.763 1.1e-02
colon cancer -1.200 1.6e-02
cystic fibrosis 2.823 7.0e-05
dermatomyositis 2.100 1.8e-03
Down syndrome 1.200 1.2e-02
Duchenne muscular dystrophy 1.430 6.2e-07
ductal carcinoma in situ -1.800 3.9e-04
ependymoma -1.700 1.2e-04
fibroadenoma -1.600 2.4e-02
glioblastoma -1.600 9.3e-03
group 3 medulloblastoma -3.100 6.8e-04
head and neck cancer and chronic obstruc... 1.200 1.6e-02
intraductal papillary-mucinous adenoma (... -2.100 1.6e-02
intraductal papillary-mucinous carcinoma... -1.500 2.7e-02
invasive ductal carcinoma -1.664 7.8e-05
juvenile dermatomyositis 1.751 1.1e-09
lung adenocarcinoma -1.900 5.1e-12
lung cancer -2.100 5.3e-04
lung carcinoma 1.100 1.5e-04
medulloblastoma, large-cell -2.600 2.0e-03
non primary Sjogren syndrome sicca 1.100 1.6e-02
oligodendroglioma -2.300 3.3e-08
ovarian cancer -1.900 1.0e-03
pancreatic cancer 1.500 7.8e-03
pancreatic ductal adenocarcinoma liver m... -1.064 1.9e-02
periodontitis 1.100 6.3e-22
Pick disease -1.700 2.4e-02
progressive supranuclear palsy -1.600 2.0e-02
pterygium 1.300 3.0e-03
subependymal giant cell astrocytoma -3.438 2.9e-02
type II diabetes mellitus and post-ische... 1.900 3.7e-02
ulcerative colitis 2.600 8.4e-06

 GWAS Trait (2)

Gene RIF (114)

AA Sequence

MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAG      1 - 70
PPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKG     71 - 140
ESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKT    141 - 210
FPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVI    211 - 280
PHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHR    281 - 350
CVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH    351 - 420
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVG    421 - 490
YGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTMPEEVTRPNYPGIMYLQ    491 - 560
SDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPL    561 - 630
WTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVT    631 - 700
NMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYS    701 - 770
IITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR    771 - 840
KTSRSYPEILTLKTYLHTYESEI                                                   841 - 863
//

Text Mined References (136)

PMID Year Title