Property Summary

NCBI Gene PubMed Count 54
PubMed Score 29.02
PubTator Score 74.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.700 2.8e-02
adult high grade glioma -1.100 2.7e-02
autosomal dominant Emery-Dreifuss muscul... 1.480 1.1e-03
Breast cancer -1.300 4.9e-04
breast carcinoma -1.200 6.0e-06
Duchenne muscular dystrophy 1.119 4.6e-06
gastric carcinoma 1.500 3.4e-02
glioblastoma -1.200 1.3e-02
intraductal papillary-mucinous neoplasm ... -1.400 3.9e-02
invasive ductal carcinoma -1.900 1.9e-03
lung cancer -1.700 3.1e-04
lung carcinoma -1.200 1.8e-09
non-small cell lung cancer -1.413 7.7e-11
oligodendroglioma -1.300 3.6e-02
osteosarcoma -2.395 3.3e-04
ovarian cancer 1.400 3.8e-02
pancreatic cancer 1.500 2.1e-03
pancreatic ductal adenocarcinoma liver m... -1.897 2.7e-03

Gene RIF (41)

AA Sequence

MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKA      1 - 70
DSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVL     71 - 140
ACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMG    141 - 210
APGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIF    211 - 280
RADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEE    281 - 350
QLALTGDGAYNAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN    351 - 420
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVN    421 - 490
CLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVA    491 - 560
HVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ    561 - 630
LQGKLLLSSMDEKTLYLALGAVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLE    631 - 700
SDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVD    701 - 770
TSITGIMSPTSFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM    771 - 840
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLTAHCNFSALAK    841 - 910
EESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVG    911 - 980
WIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ                   981 - 1035
//

Text Mined References (57)

PMID Year Title