Property Summary

NCBI Gene PubMed Count 49
PubMed Score 25.56
PubTator Score 74.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 9.58476834139543E-27
non-small cell lung cancer 2798 7.74765970194343E-11
lung carcinoma 2844 1.77392815495855E-9
Duchenne muscular dystrophy 602 4.64824028567119E-6
lung cancer 4473 3.07473472653681E-4
osteosarcoma 7933 3.28050513255488E-4
Breast cancer 3099 4.91731477126183E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00106450718884824
invasive ductal carcinoma 2950 0.00186495428822088
pancreatic cancer 2300 0.00207405950002448
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00269176038415404
glioblastoma 5572 0.0130184837434431
adult high grade glioma 2148 0.0268442048526741
acute myeloid leukemia 785 0.0283106278902334
gastric carcinoma 832 0.0335423220841739
oligodendroglioma 2849 0.0360792435482002
ovarian cancer 8492 0.0375069872687026
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0393599864719749
Disease Target Count Z-score Confidence
Lymphedema 26 3.581 1.8

Expression

  Differential Expression (18)

Synonym

Accession Q13797 Q14638
Symbols RLC
ITGA4L
ALPHA-RLC

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (36)

PMID Text
26372814 ITGA9 gene promoter is hypermethylated and downregulated in nasopharyngeal carcinoma.
25748048 p75(NTR) and alpha9 integrin subunit are not closely associated through their cytoplasmic domains, most probably because of the molecular interference with other cytoplasmic proteins such as paxillin.
24241034 alpha9beta1 integrin acts as a critical intrinsic regulator of human rheumatoid arthritis.
22976797 Neuronal cadherin and alpha9-integrin are postulated as leading actors in the association between the Notch pathway and promotion of cell adhesion, motility and invasion in rhabdomyosarcoma cells
22545097 Differential capacity for VEGF-D production and integrin alpha 9 beta 1 expression by human breast cancer cell line MDA-MB-468LN jointly contributed to their lymphatic metastatic phenotype.
22370635 integrin alpha9beta1 is expressed in primary small cell lung cancer and patients having a high expression of alpha9beta1 demonstrated significantly worse long-term survival compared with patients with low alpha9beta1 expression
21975548 Integrin alpha9 (ITGA9) expression and epigenetic silencing in human breast tumors
21764681 rs189897 and rs2212020 genotypes of the ITGA9 are closely related to cerebral infarction, and the A-C haplotype is a protective factor against cerebral infarction.
21465533 endostatin reduces colorectal tumor-induced lymphangiogenesis, at least in part, by inhibiting EDA-integrin alpha9 pathway.
21341269 expression of alpha9beta1 in breast cancer; alpha9beta1 acts as novel marker of basal-like breast cancer subtype; expression associated with reduced survival; its ability to promote cell migration and invasion suggests it contributes to aggressiveness of this subtype
More...

AA Sequence

MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKA      1 - 70
DSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVL     71 - 140
ACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMG    141 - 210
APGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIF    211 - 280
RADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEE    281 - 350
QLALTGDGAYNAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN    351 - 420
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVN    421 - 490
CLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVA    491 - 560
HVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ    561 - 630
LQGKLLLSSMDEKTLYLALGAVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLE    631 - 700
SDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVD    701 - 770
TSITGIMSPTSFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM    771 - 840
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLTAHCNFSALAK    841 - 910
EESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVG    911 - 980
WIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ                   981 - 1035
//

Text Mined References (52)

PMID Year Title
26372814 2015 Integrin ?9 gene promoter is hypermethylated and downregulated in nasopharyngeal carcinoma.
25748048 2015 Association of p75(NTR) and ?9?1 integrin modulates NGF-dependent cellular responses.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24241034 2014 ?9?1 integrin acts as a critical intrinsic regulator of human rheumatoid arthritis.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23139255 2012 Novel loci associated with PR interval in a genome-wide association study of 10 African American cohorts.
22976797 2012 Notch-mediated induction of N-cadherin and ?9-integrin confers higher invasive phenotype on rhabdomyosarcoma cells.
22545097 2012 Co-expression of ?9?1 integrin and VEGF-D confers lymphatic metastatic ability to a human breast cancer cell line MDA-MB-468LN.
22370635 2013 Integrin ?9?1 promotes malignant tumor growth and metastasis by potentiating epithelial-mesenchymal transition.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
More...