Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.05
PubTator Score 23.19

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.118 0.047

Synonym

Accession Q13795 A0A087WY13 B7ZKX7 E1P5J9 Q6IBQ0 V9GYH4 ARF-related protein 1
Symbols ARP
Arp1
ARL18

Gene

Gene RIF (6)

PMID Text
26881067 One or more of 7 genes residing in a chromosome 20q13.3 CNV region appears to influence BMI. The strongest candidate is ARFRP1.
23326640 Propose that Arfrp1 exposes a binding site on AP-1 that recognizes the Vangl2 sorting motif for capture into a transport vesicle destined for the proximal surface of a polarized epithelial cell.
22505585 The GTPase ARFRP1 controls the lipidation of chylomicrons in the Golgi of the intestinal epithelium.
19224922 Results show that ARL1 and ARFRP1 regulate retrograde transport of Shiga toxin to the TGN and anterograde transport of VSVG from the TGN, respectively.
17127620 These data suggest that lethality of Arfrp1 knockout embryos is due to a specific disruption of protein targeting, e.g., of ARL1 and Golgin-245, to the Golgi.
16129887 Data show that ADP-ribosylation factor-related protein 1 (ARFRP1) is associated mainly with the trans-Golgi compartment and the trans-Golgi network (TGN) and is an essential regulatory factor for targeting of golgin-97 and golgin-245 onto Golgi membranes.

AA Sequence

MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKAR      1 - 70
LMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVET     71 - 140
CLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT             141 - 201
//

Publication (18)

PMID Year Title
26881067 2015 A Copy Number Variant on Chromosome 20q13.3 Implicated in Thinness and Severe Obesity.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23326640 2013 A novel GTP-binding protein-adaptor protein complex responsible for export of Vangl2 from the trans Golgi network.
22505585 2012 The GTPase ARFRP1 controls the lipidation of chylomicrons in the Golgi of the intestinal epithelium.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19224922 2009 Differential effects of depletion of ARL1 and ARFRP1 on membrane trafficking between the trans-Golgi network and endosomes.
17127620 Knockout of Arfrp1 leads to disruption of ARF-like1 (ARL1) targeting to the trans-Golgi in mouse embryos and HeLa cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16129887 2005 Roles of ARFRP1 (ADP-ribosylation factor-related protein 1) in post-Golgi membrane trafficking.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...