Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.77
PubTator Score 23.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.118 4.7e-02

Gene RIF (7)

AA Sequence

MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKAR      1 - 70
LMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVET     71 - 140
CLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT             141 - 201
//

Text Mined References (19)

PMID Year Title