Property Summary

NCBI Gene PubMed Count 108
PubMed Score 462.25
PubTator Score 592.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Chronic Lymphocytic Leukemia 262
Disease Target Count Z-score Confidence
Cancer 2499 5.249 2.6

Expression

  Differential Expression (35)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.930 7.0e-04
acute myeloid leukemia 1.400 2.0e-02
adrenocortical carcinoma 2.117 5.9e-03
atypical teratoid / rhabdoid tumor 1.300 1.1e-02
Bipolar Disorder 1.706 4.7e-02
ductal carcinoma in situ 1.100 1.5e-02
ependymoma 1.200 4.8e-04
gastric cancer -1.200 4.2e-03
glioblastoma 1.500 1.4e-03
hepatocellular carcinoma -1.600 6.5e-05
intraductal papillary-mucinous carcinoma... 2.000 6.1e-03
intraductal papillary-mucinous neoplasm ... 2.300 3.3e-03
invasive ductal carcinoma 1.409 2.6e-02
lung adenocarcinoma 1.036 4.3e-02
lung cancer 2.200 5.0e-05
malignant mesothelioma 1.300 2.0e-04
medulloblastoma 1.200 1.9e-02
medulloblastoma, large-cell 2.100 1.4e-03
nasopharyngeal carcinoma 1.700 1.0e-02
non primary Sjogren syndrome sicca -1.400 1.1e-02
non-small cell lung cancer 1.463 1.3e-10
osteosarcoma 3.249 4.3e-05
ovarian cancer 1.100 1.6e-02
pancreatic cancer -1.800 1.4e-03
pancreatic carcinoma -1.800 1.4e-03
pancreatic ductal adenocarcinoma liver m... 1.286 1.5e-02
pediatric high grade glioma 2.500 8.3e-05
pituitary cancer -4.400 9.1e-07
primitive neuroectodermal tumor 2.800 4.3e-05
psoriasis 1.200 4.2e-05
pterygium -1.600 3.9e-02
spina bifida -2.447 4.4e-02
ulcerative colitis 2.400 5.9e-09
urothelial carcinoma -1.600 2.1e-02
Waldenstrons macroglobulinemia 3.155 5.1e-03

Gene RIF (91)

AA Sequence

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT                      1 - 54
//

Text Mined References (112)

PMID Year Title