Property Summary

NCBI Gene PubMed Count 100
Grant Count 169
R01 Count 110
Funding $12,315,781.87
PubMed Score 440.94
PubTator Score 592.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13794 B2R4T7 Q8N589 PMA-induced protein 1
Symbols APR
NOXA

Gene

PDB

3MQP  

Gene RIF (83)

PMID Text
26497683 Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 SATB1 as a Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes
25975837 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death.
25829494 CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis
25714012 Noxa demethylation has a role in Bortezomib resistance in mantle cell lymphoma
25429623 Cells overexpressing HSP70 had higher levels of miR-23a, maintained these levels after heat shock and accumulated lower levels of NOXA mRNA and protein.
25404713 Overexpression of nonphosphorylatable Noxa resulted in enhanced mitochondria-mediated apoptosis in the infected epithelium.
25365078 Results reveal that oncogenic activation of MEK/ERK drives Noxa expression to promote autophagy, and suggest that Noxa has an indirect anti-apoptosis role in melanoma cells under nutrient starvation conditions.
25210795 Mcl-1/Noxa axis is important to overcome resistance to mitochondrial apoptosis in squamous cell carcinoma.
More...

AA Sequence

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT                      1 - 54
//

Text Mined References (104)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26497683 2015 A novel prohibitin-binding compound induces the mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 2015 SATB1 Mediates Long-Range Chromatin Interactions: A Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes.
25975837 2015 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 2015 The NOXA-MCL1-BIM axis defines lifespan on extended mitotic arrest.
25829494 2015 Heat shock inhibition of CDK5 increases NOXA levels through miR-23a repression.
25714012 2015 Harnessing Noxa demethylation to overcome Bortezomib resistance in mantle cell lymphoma.
25429623 2014 The elimination of miR-23a in heat-stressed cells promotes NOXA-induced cell death and is prevented by HSP70.
25404713 2015 Regulation of Noxa-mediated apoptosis in Helicobacter pylori-infected gastric epithelial cells.
25365078 2014 Noxa upregulation by oncogenic activation of MEK/ERK through CREB promotes autophagy in human melanoma cells.
More...