Property Summary

NCBI Gene PubMed Count 100
PubMed Score 440.94
PubTator Score 592.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.33998751716361E-10
ulcerative colitis 2087 5.85424880488961E-9
pituitary cancer 1972 9.08007624122481E-7
psoriasis 6685 2.28807873677167E-5
sonic hedgehog group medulloblastoma 1482 2.29985384826516E-5
posterior fossa group A ependymoma 1511 4.272171441207E-5
osteosarcoma 7933 4.29571105909144E-5
primitive neuroectodermal tumor 3031 4.33323224389064E-5
lung cancer 4473 5.01136144446991E-5
hepatocellular carcinoma 550 6.48000325160856E-5
pediatric high grade glioma 2712 8.33089916493592E-5
malignant mesothelioma 3163 2.01822822143627E-4
glioblastoma 5572 3.42690112480437E-4
medulloblastoma, large-cell 6234 0.00140570858827138
pancreatic carcinoma 567 0.00143401286206936
pancreatic cancer 2300 0.00143401286206937
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00329558526747987
nasopharyngeal carcinoma 1056 0.00393944549657432
gastric cancer 436 0.00415247297297169
Waldenstrons macroglobulinemia 765 0.00510379273629548
adrenocortical carcinoma 1427 0.00587883355538772
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00605138150140246
ovarian cancer 8492 0.00750557384214593
atypical teratoid / rhabdoid tumor 4369 0.0106078570420886
non primary Sjogren syndrome sicca 840 0.0113307809992084
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0148361336040918
ductal carcinoma in situ 1745 0.0154767067952736
urothelial carcinoma 318 0.0210738403636496
invasive ductal carcinoma 2950 0.0257482965744331
acute myeloid leukemia 785 0.0385155735809662
pterygium 74 0.0387276245126458
lung adenocarcinoma 2714 0.0427497961457762
spina bifida 1064 0.0435677332899902
Bipolar Disorder 266 0.047162168458973
Disease Target Count Z-score Confidence
Cancer 2346 5.183 2.6

Expression

Synonym

Accession Q13794 B2R4T7 Q8N589 PMA-induced protein 1
Symbols APR
NOXA

Gene

PDB

3MQP  

  Ortholog (1)

Species Source
Dog EggNOG Inparanoid

Gene RIF (83)

PMID Text
26497683 Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 SATB1 as a Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes
25975837 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death.
25829494 CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis
25714012 Noxa demethylation has a role in Bortezomib resistance in mantle cell lymphoma
25429623 Cells overexpressing HSP70 had higher levels of miR-23a, maintained these levels after heat shock and accumulated lower levels of NOXA mRNA and protein.
25404713 Overexpression of nonphosphorylatable Noxa resulted in enhanced mitochondria-mediated apoptosis in the infected epithelium.
25365078 Results reveal that oncogenic activation of MEK/ERK drives Noxa expression to promote autophagy, and suggest that Noxa has an indirect anti-apoptosis role in melanoma cells under nutrient starvation conditions.
25210795 Mcl-1/Noxa axis is important to overcome resistance to mitochondrial apoptosis in squamous cell carcinoma.
More...

AA Sequence

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT                      1 - 54
//

Text Mined References (104)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26497683 2015 A novel prohibitin-binding compound induces the mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 2015 SATB1 Mediates Long-Range Chromatin Interactions: A Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes.
25975837 2015 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 2015 The NOXA-MCL1-BIM axis defines lifespan on extended mitotic arrest.
25829494 2015 Heat shock inhibition of CDK5 increases NOXA levels through miR-23a repression.
25714012 2015 Harnessing Noxa demethylation to overcome Bortezomib resistance in mantle cell lymphoma.
25429623 2014 The elimination of miR-23a in heat-stressed cells promotes NOXA-induced cell death and is prevented by HSP70.
25404713 2015 Regulation of Noxa-mediated apoptosis in Helicobacter pylori-infected gastric epithelial cells.
25365078 2014 Noxa upregulation by oncogenic activation of MEK/ERK through CREB promotes autophagy in human melanoma cells.
More...