Property Summary

NCBI Gene PubMed Count 22
PubMed Score 33.30
PubTator Score 21.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.783 3.4e-03

Gene RIF (12)

AA Sequence

MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHP      1 - 70
KSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNV     71 - 140
SVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNLGTALYYATQNCLGKA    141 - 210
RERGRDGAIDLGYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRA    211 - 280
ISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI                            281 - 326
//

Text Mined References (25)

PMID Year Title