Property Summary

NCBI Gene PubMed Count 21
Grant Count 15
R01 Count 13
Funding $1,512,797.33
PubMed Score 35.43
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.783 0.003

Gene RIF (12)

PMID Text
25726912 Direct interactions between C/EBPalpha and ETS-1 were important for high liver-specific expression of ApoF.
24211198 this study has identified apoF as likely another target gene of FXR.
21937674 LTIP translocation is dependent on LDL lipid composition
20855565 Observational study of gene-disease association. (HuGE Navigator)
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
18369235 lipoprotein composition may influence the status of lipid transfer inhibitor protein activity
17901467 we have confirmed the negative association between plasma triglyceride levels and Apolipoprotein F previously suggested by a small data set, but now we demonstrate that this effect is seen only in males.
More...

AA Sequence

MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHP      1 - 70
KSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNV     71 - 140
SVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNLGTALYYATQNCLGKA    141 - 210
RERGRDGAIDLGYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRA    211 - 280
ISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI                            281 - 326
//

Text Mined References (24)

PMID Year Title
25726912 2015 Transcriptional regulation of the apolipoprotein F (ApoF) gene by ETS and C/EBP? in hepatoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211198 2013 Farnesoid X receptor up-regulates expression of lipid transfer inhibitor protein in liver cells and mice.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21937674 2011 Conversion of lipid transfer inhibitor protein (apolipoprotein F) to its active form depends on LDL composition.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
More...