Property Summary

NCBI Gene PubMed Count 38
PubMed Score 23.30
PubTator Score 136.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Skeletal muscle neoplasm 8 4.572 2.3

Expression

Gene RIF (13)

AA Sequence

MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQS      1 - 70
RSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAA     71 - 140
EKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAI    141 - 210
MELTM                                                                     211 - 215
//

Text Mined References (53)

PMID Year Title