Property Summary

NCBI Gene PubMed Count 267
Grant Count 70
R01 Count 48
Funding $8,080,243.92
PubMed Score 492.33
PubTator Score 475.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma 1.400 0.000
pancreatic cancer -1.200 0.008
malignant mesothelioma 4.300 0.000
atypical teratoid / rhabdoid tumor 1.400 0.003
sonic hedgehog group medulloblastoma 1.400 0.013
colon cancer 2.000 0.030
lung cancer -2.100 0.000
interstitial cystitis 2.100 0.003
pediatric high grade glioma 1.100 0.000
posterior fossa group A ependymoma 1.800 0.000
pancreatic carcinoma -1.200 0.008
Breast cancer -1.600 0.000
ulcerative colitis 2.000 0.000
ovarian cancer 1.400 0.005

Synonym

Accession Q13761 B1AJV5 Q12969 Q13760
Symbols AML2
CBFA3
PEBP2aC

Gene

PANTHER Protein Class (1)

Gene RIF (254)

PMID Text
26853927 RUNX 3 promoter hypermethylation can lead to down-regulation of RUNX3 in laryngeal squamous cell carcinoma.
26708741 In the present review, we summarize the proposed roles of RUNX3 in metastasis and, when applicable, highlight the mechanism by which they function.
26634516 the AA genotype and A allele of rs2236852 polymorphism confer a decreased CRC risk, while the TA haplotype (rs760805 and rs2236852) increases the risk for CRC development in Mexican patients.
26520896 HMGB1 contributed to IFN-gamma-producing Th17-cell bias in coronary artery atherosclerosis by controlling expression of T-bet and RUNX3.
26475207 Exogenous expression of RUNX3 resulted in the enhancement of Ara-C resistance in K562 cells. RUNX3 is a downstream target of FLT3-ITD. RUNX3 is a prerequisite for Ara-C resistance via FLT3-ITD signaling.
26375442 Targeting miR-130a and miR-495 could be a potential therapeutics to recover RUNX3 expression under hypoxic conditions and in early tumorigenic progression.
26239696 we show that RUNX3 and RUNX3-regulated chemokines are linked to non-small cell lung cancer-mediated bone resorption
26233263 common susceptibility gene shared by systemic lupus erythematosus and psoriasis as well as ankylosing spondylitis
26186909 Overexpression of RUNX3 increased cIAP2 expression in A2780s cells, whereas inhibition of RUNX3 decreased cIAP2 expression and potentiated carboplatin-induced decrease of cIAP2 in A2780cp cells.
26175272 Hypermethylation of RUNX3/CAMK2N1 is associated with poor clinical outcome in Type II EOC, also after macroscopic complete resection.
More...

AA Sequence

MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD      1 - 70
SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF     71 - 140
VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP    141 - 210
STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY    211 - 280
SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS    281 - 350
SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY         351 - 415
//

Text Mined References (268)

PMID Year Title
26853927 2016 Association of RUNX3 Methylation with Clinical Outcome and Cell Migration/Invasion in Laryngeal Squamous Cell Carcinoma.
26708741 2016 The emerging role of RUNX3 in cancer metastasis (Review).
26634516 2015 RUNX3 gene polymorphisms and haplotypes in Mexican patients with colorectal cancer.
26520896 2015 IFN-?-producing Th17 cells bias by HMGB1-T-bet/RUNX3 axis might contribute to progression of coronary artery atherosclerosis.
26475207 2015 FLT3-ITD drives Ara-C resistance in leukemic cells via the induction of RUNX3.
26375442 2015 Targeting of RUNX3 by miR-130a and miR-495 cooperatively increases cell proliferation and tumor angiogenesis in gastric cancer cells.
26239696 2015 Loss of RUNX3 expression promotes cancer-associated bone destruction by regulating CCL5, CCL19 and CXCL11 in non-small cell lung cancer.
26233263 2015 RUNX3 gene polymorphisms are associated with clinical features of systemic lupus erythematosus in Chinese Han population.
26186909 2015 RUNX3 contributes to carboplatin resistance in epithelial ovarian cancer cells.
26175272 2016 RUNX3 and CAMK2N1 hypermethylation as prognostic marker for epithelial ovarian cancer.
More...