Property Summary

NCBI Gene PubMed Count 301
PubMed Score 536.17
PubTator Score 475.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma 1.100 1.4e-04
adult high grade glioma 1.100 1.3e-03
atypical teratoid / rhabdoid tumor 1.400 2.7e-03
Breast cancer -1.600 8.0e-08
colon cancer 2.000 3.0e-02
interstitial cystitis 2.000 2.0e-03
lung cancer -1.800 8.4e-05
malignant mesothelioma 4.100 1.5e-07
medulloblastoma 1.200 4.5e-02
ovarian cancer 1.400 5.2e-03
pancreatic cancer -1.200 8.0e-03
pancreatic carcinoma -1.200 8.0e-03
posterior fossa group A ependymoma 1.600 9.5e-07
ulcerative colitis 1.500 7.4e-04

Protein-protein Interaction (2)

Gene RIF (288)

AA Sequence

MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD      1 - 70
SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF     71 - 140
VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP    141 - 210
STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY    211 - 280
SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS    281 - 350
SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY         351 - 415
//

Text Mined References (303)

PMID Year Title