Property Summary

NCBI Gene PubMed Count 115
PubMed Score 104.82
PubTator Score 92.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (9)

Disease Target Count P-value
lung carcinoma 2844 2.71600228319903E-27
Breast cancer 3099 3.10250788322278E-9
malignant mesothelioma 3163 4.1139586610138E-9
pancreatic cancer 2300 1.35618065778639E-7
psoriasis 6685 2.17117665790006E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00118525218052927
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00177239240949255
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00233059767110003
non-small cell lung cancer 2798 0.00244769582090747
cystic fibrosis 1670 0.00422723796039853
lung cancer 4473 0.00436071933373041
primary pancreatic ductal adenocarcinoma 1271 0.00604753663685113
active ulcerative colitis 477 0.00844096233357041
Barrett's esophagus 185 0.0121560485128422
breast carcinoma 1614 0.0136146042719508
esophageal adenocarcinoma 737 0.0180659511873377
ovarian cancer 8492 0.0196452193067325
medulloblastoma, large-cell 6234 0.0234257070825513
non diabetic and post-ischemic heart failure 200 0.0293086530993196
chronic kidney disease 90 0.0446843342941263
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Junctional epidermolysis bullosa 9 0.0 5.0
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 6.524 3.3
Disease Target Count Z-score Confidence
Cancer 2346 3.037 1.5

Expression

Synonym

Accession Q13753 Q02536 Q02537 Q13752 Q14941 Q14DF7 Q2M1N2 Q5VYE8
Symbols B2T
CSF
EBR2
BM600
EBR2A
LAMB2T
LAMNB2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

 CSPA Cell Line (3)

Gene RIF (81)

PMID Text
26450632 findings strongly indicate that Ln-gamma2 is an attractive biomarker for detecting early stages of UC and for monitoring recurrence
26246502 Laminin expression depends on Ecad loss and allows Ecad-defective gastric cancer cells to survive and invade.
26180921 LAMC2 is a novel non-small cell lung cancer prognostic factor.
25795733 Diagnostic value of p40 and LN332 in metaplastic spindle cell carcinoma of the breast was found to be less than that of routinely used markers (p63 and cytokeratins). LN332 showed staining in a significant proportion of phyllodes tumours and sarcomas.
25773857 The positive expression of laminingamma2 and the tumor differentiation were independent risk factors influencing the prognosis of EHCC patients.
25591736 Data suggest that LAMC2 promotes metastasis in lung adenocarcinoma via EMT and may be a potential therapeutic target.
24976367 The elevated expression of LAMC2 on cancer cells appears to drive tumorigenesis through its interactions with several cell-surface receptors
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24550734 Through an unbiased genetic approach involving a combination of QTL mapping and positional cloning, we demonstrate that Col17a1 is a strong genetic modifier of the non-Herlitz JEB that develops in Lamc2(jeb) mice
24238220 The active site of gamma2pf to the N-terminal epidermal growth factor-like repeat.
More...

AA Sequence

MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNTDGIHCEKCKN      1 - 70
GFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGFHMLTDAGCTQDQRLLDSKCD     71 - 140
CDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGNPEGCTQCFCYGHSASCRSSAEYSVHKITST    141 - 210
FHQDVDGWKAVQRNGSPAKLQWSQRHQDVFSSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGR    211 - 280
HPSAHDVILEGAGLRITAPLMPLGKTLPCGLTKTYTFRLNEHPSNNWSPQLSYFEYRRLLRNLTALRIRA    281 - 350
TYGEYSTGYIDNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG    351 - 420
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTG    421 - 490
ARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGD    491 - 560
PLAPNPADKCRACNCNPMGSEPVGCRSDGTCVCKPGFGGPNCEHGAFSCPACYNQVKIQMDQFMQQLQRM    561 - 630
EALISKAQGGDGVVPDTELEGRMQQAEQALQDILRDAQISEGASRSLGLQLAKVRSQENSYQSRLDDLKM    631 - 700
TVERVRALGSQYQNRVRDTHRLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVE    701 - 770
SASNMEQLTRETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIE    771 - 840
ADRSYQHSLRLLDSVSRLQGVSDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRTQKNLGNWKEEAQQLL    841 - 910
QNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDLQVDNRKAEAEEAMKRLSYIS    911 - 980
QKVSDASDKTQQAERALGSAAADAQRAKNGAGEALEISSEIEQEIGSLNLEANVTADGALAMEKGLASLK    981 - 1050
SEMREVEGELERKELEFDTNMDAVQMVITEAQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGL   1051 - 1120
VLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQAL   1121 - 1190
EQQ                                                                      1191 - 1193
//

Text Mined References (116)

PMID Year Title
26450632 2015 Urinary laminin-?2 is a novel biomarker of non-muscle invasive urothelial carcinoma.
26246502 2015 E-cadherin-defective gastric cancer cells depend on Laminin to survive and invade.
26180921 2015 Serum LAMC2 enhances the prognostic value of a multi-parametric panel in non-small cell lung cancer.
25795733 2015 Expression of p40 and laminin 332 in metaplastic spindle cell carcinoma of the breast compared with other malignant spindle cell tumours.
25773857 2015 Expression of Laminin?2 in extrahepatic cholangiocarcinoma tissues and its influence on tumor invasion and metastasis.
25591736 2015 LAMC2 enhances the metastatic potential of lung adenocarcinoma.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24976367 2014 LAMC2 as a therapeutic target for cancers.
24550734 2014 Molecular identification of collagen 17a1 as a major genetic modifier of laminin gamma 2 mutation-induced junctional epidermolysis bullosa in mice.
24238220 2014 Amino-terminal fragments of laminin ?2 chain retract vascular endothelial cells and increase vascular permeability.
More...