Property Summary

NCBI Gene PubMed Count 134
PubMed Score 326.41
PubTator Score 268.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.748 7.3e-03
astrocytic glioma 2.000 5.3e-03
Astrocytoma, Pilocytic 1.300 3.2e-04
Breast cancer 3.300 2.5e-02
chronic rhinosinusitis -1.108 2.5e-02
colon cancer 1.200 1.9e-02
cutaneous lupus erythematosus -1.100 3.2e-02
cystic fibrosis and chronic rhinosinusit... -1.061 4.1e-02
ductal carcinoma in situ 1.600 4.6e-02
ependymoma -1.400 1.1e-04
esophageal adenocarcinoma 1.600 5.0e-02
glioblastoma -1.100 1.8e-02
group 3 medulloblastoma -2.300 3.1e-03
interstitial cystitis -1.900 6.0e-04
invasive ductal carcinoma 1.114 1.3e-02
lung cancer -1.100 1.9e-04
medulloblastoma, large-cell -1.700 3.5e-02
nasopharyngeal carcinoma -1.400 1.9e-02
oligodendroglioma 1.800 2.1e-02
ovarian cancer -1.100 3.4e-03
progressive supranuclear palsy -1.500 7.0e-03
psoriasis -1.400 2.2e-08
Rheumatoid arthritis 1.100 3.2e-03
tuberculosis -1.900 5.4e-04
ulcerative colitis 1.400 1.5e-05

Protein-protein Interaction (2)

Gene RIF (111)

AA Sequence

MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAF      1 - 70
RSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIV     71 - 140
SKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTT    141 - 210
KADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEE    211 - 280
FLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDAL    281 - 350
PVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM    351 - 420
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQ    421 - 490
LERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKH    491 - 560
VNKDLGNMEENKKLEENNHKTEA                                                   561 - 583
//

Text Mined References (144)

PMID Year Title