Property Summary

NCBI Gene PubMed Count 122
Grant Count 59
R01 Count 29
Funding $5,839,221.25
PubMed Score 299.94
PubTator Score 268.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.017
astrocytic glioma 2.200 0.007
oligodendroglioma 1.900 0.016
esophageal adenocarcinoma 1.600 0.050
psoriasis -2.700 0.000
cutaneous lupus erythematosus -1.100 0.032
posterior fossa group B ependymoma -2.000 0.000
group 4 medulloblastoma -4.100 0.000
glioblastoma -1.100 0.018
medulloblastoma, large-cell -1.700 0.035
tuberculosis -2.800 0.000
colon cancer 1.300 0.018
lung cancer -1.200 0.000
active Crohn's disease 1.890 0.002
Breast cancer 3.300 0.025
interstitial cystitis -1.900 0.001
pilocytic astrocytoma 1.500 0.000
invasive ductal carcinoma 2.100 0.006
nasopharyngeal carcinoma -1.400 0.019
progressive supranuclear palsy -1.500 0.007
ductal carcinoma in situ 1.600 0.046
ulcerative colitis 1.400 0.000
ovarian cancer -2.300 0.000
chronic rhinosinusitis -1.108 0.025
cystic fibrosis and chronic rhinosinusit... -1.061 0.041

Synonym

Accession Q13740 B2RNS3 B4DTU0 O60892 Q1HGM8 Q1HGM9 Q6PEY4 Q6ZS95
Symbols MEMD
CD166

Gene

PDB

1KJC   5A2F  

 GO Function (1)

Gene RIF (99)

PMID Text
26146185 The binding sites on CD6 and CD166 have been characterized to show that a SNP in CD6 causes glycosylation that hinders the CD6/CD166 interaction.
26134500 High ALCAM expression in melanoma cells of the primary tumor may indicate a more invasive phenotype. Low expression of ALCAM in regional lymph node metastases is a feature associated with unfavorable prognosis in patients with cutaneous melanoma.
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1
25987048 High ALCAM expression is associated with Invasive Cholangiocarcinoma.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25562819 The Serum CD166 is a novel diagnostic tumor marker for hepatocellular carcinoma (HCC).
25539763 Differentially expressed/regulated cancer-related genes upon miR-125b expression along with the significant increase of ALCAM
25472586 an overexpression of CD166 was detected in the benign and malignant salivary gland tumors and its expression in the malignant tumor was associated with the aggressive behavior and tumor progression.
25420915 CD14(+)CD16(+) monocytes selectively transmigrated across our BBB model as a result of their increased JAM-A and ALCAM expression.
25395097 Overexpression of activated leukocute cell adhesion molecule in gastric cancer is associated with advanced stages and poor prognosis and miR-9 deregulation
More...

AA Sequence

MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAF      1 - 70
RSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIV     71 - 140
SKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTT    141 - 210
KADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEE    211 - 280
FLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDAL    281 - 350
PVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM    351 - 420
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQ    421 - 490
LERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKH    491 - 560
VNKDLGNMEENKKLEENNHKTEA                                                   561 - 583
//

Text Mined References (132)

PMID Year Title
26146185 2015 Structures of CD6 and Its Ligand CD166 Give Insight into Their Interaction.
26134500 2015 Prognostic significance of ALCAM (CD166/MEMD) expression in cutaneous melanoma patients.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25987048 2015 ALCAM is a Novel Cytoplasmic Membrane Protein in TNF-? Stimulated Invasive Cholangiocarcinoma Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25562819 2015 Serum CD166: a novel hepatocellular carcinoma tumor marker.
25539763 2015 ALCAM is indirectly modulated by miR-125b in MCF7 cells.
25472586 2015 Clinical implication of CD166 expression in salivary gland tumor.
25420915 2015 JAM-A and ALCAM are therapeutic targets to inhibit diapedesis across the BBB of CD14+CD16+ monocytes in HIV-infected individuals.
More...