Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.86
PubTator Score 5.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -3.100 0.007
lung adenocarcinoma -1.200 0.000

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (9)

Gene RIF (3)

PMID Text
25640246 Human ATP1A4 enhances mouse sperm motility and hyperactivity during capacitation.
16894555 These results constitute the first demonstration of the transcriptional control of ATP1A4 gene expression by cAMP and by CREMtau, a transcription factor essential for male germ cell gene expression.
16175638 Human Na,K-ATPase alpha 4 isoform is a sperm-specific protein localized to the flagellum, suggesting a role for human Na,K-ATPase alpha 4 isoform in human sperm physiology.

AA Sequence

MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKG      1 - 70
HSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCFVAYSIQIYFNEEPTKDNLYL     71 - 140
SIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVIRGGEKMQINVQEVVLGDLVEIKGGDRVPAD    141 - 210
LRLISAQGCKVDNSSLTGESEPQSRSPDFTHENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIAS    211 - 280
LTSGLAVGQTPIAAEIEHFIHLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTV    281 - 350
CLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT    351 - 420
KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMREKNPKVAEIPF    421 - 490
NSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDEMKEAFQNAYLELGGLGERVL    491 - 560
GFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITA    561 - 630
KAIAKGVGIISEGTETAEEVAARLKIPISKVDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTS    631 - 700
PQQKLIIVEGCQRLGAVVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEE    701 - 770
GRLIFDNLKKSIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR    771 - 840
LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDSYGQ    841 - 910
QWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGM    911 - 980
DVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPDGWVERETYY                         981 - 1029
//

Publication (20)

PMID Year Title
25640246 2015 Role of human Na,K-ATPase alpha 4 in sperm function, derived from studies in transgenic mice.
16894555 2006 The transcription factor CREMtau and cAMP regulate promoter activity of the Na,K-ATPase alpha4 isoform.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16175638 2006 The human Na,K-ATPase alpha 4 isoform is a ouabain-sensitive alpha isoform that is expressed in sperm.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15071553 2004 Biology, structure and mechanism of P-type ATPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12763850 2003 Functional roles of the alpha isoforms of the Na,K-ATPase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...