Property Summary

NCBI Gene PubMed Count 55
Grant Count 44
R01 Count 21
Funding $2,755,202.08
PubMed Score 106.68
PubTator Score 60.18

Knowledge Summary

Patent (65,695)

Expression

  Differential Expression (10)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (20)

PMID Text
26289399 ActR-IIB is expressed in male germ cells and Sertoli cells.
26086422 Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors.
26047946 Activin A inhibited signaling by BMP-6 and BMP-9 by competing for type 2 receptors ACVR2A and ACVR2B.
25203845 miR-21 interacts directly with the 3'-untranslated region of ACVR2B mRNA. Mechanical stretch suppressed ACVR2B protein levels in periodontal ligament stem cells. Gain- and loss of function of ACVR2B mediated the osteogenic differentiation of PDLSCs.
25051287 We found that the AAAAA, AGGAG, and AGGGA haplotypes in ACVR2B were associated with susceptibility to Premature Ovarian Failure when they also had at least one CATAG haplotype in ADAMTS19.
22431721 The interaction between all five miRNAs and ACVR2B was verified by an in vitro assay.
22395277 After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed lower levels of ActRIIb while postmenopausal women using HT showed a heightened response.
22296042 Activin type IIB receptors are clearly demonstrable throughout the adult human hypothalamus and basal forebrain.
21864452 Mutations in Activin A Receptor Type IIB were identified in 4 of the 47 patients (8.5%) with heterotaxy syndrome. Our results expand the mutation spectrum of monogenic heterotaxy syndrome with associated cardiac anomalies.
21353874 discussion of crystal structure of kinase domain of ActRIIB; structural analysis may be of help in developing selective inhibitors [REVIEW]
More...

AA Sequence

MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTI      1 - 70
ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLA     71 - 140
YSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLM    141 - 210
NDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGN    211 - 280
IITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGK    281 - 350
PPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ    351 - 420
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTS    421 - 490
DCLVSLVTSVTNVDLPPKESSI                                                    491 - 512
//

Publication (58)

PMID Year Title
26289399 NODAL secreted by male germ cells regulates the proliferation and function of human Sertoli cells from obstructive azoospermia and nonobstructive azoospermia patients.
26086422 2015 Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis.
26047946 2015 Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B.
25203845 2015 microRNA-21 mediates stretch-induced osteogenic differentiation in human periodontal ligament stem cells.
25051287 2015 Epistasis between polymorphisms in ACVR2B and ADAMTS19 is associated with premature ovarian failure.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24019467 2013 Regulation of GDF-11 and myostatin activity by GASP-1 and GASP-2.
23829672 2013 Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2.
22718755 2012 Specificity and structure of a high affinity activin receptor-like kinase 1 (ALK1) signaling complex.
22431721 2012 miR-192, miR-194, miR-215, miR-200c and miR-141 are downregulated and their common target ACVR2B is strongly expressed in renal childhood neoplasms.
More...