Property Summary

NCBI Gene PubMed Count 18
PubMed Score 119.60
PubTator Score 724.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.052 1.5

Expression

Gene RIF (12)

AA Sequence

MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS      1 - 70
SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET     71 - 140
QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE    141 - 210
DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG    211 - 280
FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD    281 - 350
QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS                                   351 - 389
//

Text Mined References (21)

PMID Year Title