Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $43,735
PubMed Score 30.41
PubTator Score 15.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.262 0.000

Synonym

Accession Q13685 Q8WUJ9 Q96H92
Symbols

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
23564791 High levels of AAMP levels were associated with breast cancer progression and metastasis
21172430 angio-associated migratory cell protein was identified as a novel interacting partner of both TPalpha and TPbeta isoforms of the thromboxane A2 receptor
20237496 Observational study of gene-disease association. (HuGE Navigator)
19535145 Data support a new function of AAMP in regulating innate immune responses initiated by the NLR protein Nod2.
18634987 important functional role of AAMP in the migration of smooth muscle cells (SMCs), identifying AAMP as a potential target to limit lesion formation after injury.

AA Sequence

MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQ      1 - 70
EGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCA     71 - 140
GFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT    141 - 210
FQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSV    211 - 280
DCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQT    281 - 350
LRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG    351 - 420
DHKAKVFCVQRPDR                                                            421 - 434
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23564791 2013 The impact of angio-associated migratory cell protein (AAMP) on breast cancer cells in vitro and its clinical significance.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
21172430 2011 Interaction of angio-associated migratory cell protein with the TP? and TP? isoforms of the human thromboxane A? receptor.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19535145 2009 A function for AAMP in Nod2-mediated NF-kappaB activation.
18634987 2008 Blockade of angio-associated migratory cell protein inhibits smooth muscle cell migration and neointima formation in accelerated atherosclerosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...