Property Summary

NCBI Gene PubMed Count 51
PubMed Score 39.97
PubTator Score 41.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
ependymoma 2514 1.15426242528283E-6
pilocytic astrocytoma 3086 8.17550011613324E-6
cystic fibrosis 1670 8.92924473285747E-5
pediatric high grade glioma 2712 1.22412337659696E-4
psoriasis 6685 2.03871922551785E-4
colon cancer 1475 2.55697318462605E-4
interstitial cystitis 2299 3.52395563051125E-4
ductal carcinoma in situ 1745 3.85734929286667E-4
non-inflammatory breast cancer 208 6.28905924589928E-4
glioblastoma 5572 7.5967946270638E-4
group 3 medulloblastoma 2254 0.00125968841587342
invasive ductal carcinoma 2950 0.00149585297308777
diabetes mellitus 1663 0.00224774315036233
oligodendroglioma 2849 0.0034658666802084
breast carcinoma 1614 0.00405596240187206
fibroadenoma 557 0.0239775316038253
astrocytoma 1493 0.0246832508103825
Hydrolethalus syndrome 128 0.0316982090028752
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Congenital muscular dystrophy 25 0.0 4.0
Disease Target Count Z-score Confidence
Myopathy 128 4.163 2.1

Expression

  Differential Expression (18)

Disease log2 FC p
oligodendroglioma 1.600 0.003
psoriasis 1.200 0.000
glioblastoma 2.100 0.001
ependymoma 1.600 0.000
cystic fibrosis -1.155 0.000
astrocytoma 1.900 0.025
Hydrolethalus syndrome 1.648 0.032
colon cancer -2.100 0.000
breast carcinoma -2.000 0.004
fibroadenoma -2.400 0.024
diabetes mellitus -1.100 0.002
interstitial cystitis 1.500 0.000
pediatric high grade glioma 1.800 0.000
group 3 medulloblastoma -1.300 0.001
pilocytic astrocytoma 1.700 0.000
non-inflammatory breast cancer -1.900 0.001
ductal carcinoma in situ -3.000 0.000
invasive ductal carcinoma -3.600 0.001

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (18)

PMID Text
26320193 Data indicate that S100 calcium binding protein P (S100P) increased lung cancer cell migration by binding integrin alpha7.
26076707 Taken together, these results further support the use of a7 integrin as a potential therapy for Duchenne muscular dystrophy
26011651 Data suggest that ITGA7 is an epigenetically regulated tumour suppressor gene and a prognostic factor in human malignant pleural mesothelioma.
24227711 The absence of either alpha7beta1 integrin or alpha6beta1 integrin impairs the ability of Schwann cells to spread and to bind laminin.
24091324 Alpha7beta1D integrin modifies Ca2+ regulatory pathways and offers a means to protect the myocardium from ischemic injury.
23830872 ITGA7 binds to tissue inhibitor of metalloproteinase 3 (TIMP3) in prostate cancer cells.
23800289 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy. [ITGA7]
20651226 This report provides a novel insight into the mechanism, involving interaction with high temperature requirement A2, by which ITGA7 acts as a tumor suppressor.
20460506 ILK interaction with MCM7 and MCM7 phosphorylation may be a critical event in ITGA7 signaling pathway, leading to tumor suppression.
20453000 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWL      1 - 70
LVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC     71 - 140
AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSH    141 - 210
YLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDP    211 - 280
DQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLV    281 - 350
PEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGS    351 - 420
PDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGIKSFGYSLSGS    421 - 490
LDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPS    491 - 560
SYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKL    561 - 630
RAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCT    631 - 700
RVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGV    701 - 770
RALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVS    771 - 840
ARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWP    841 - 910
HEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWP    911 - 980
VSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKS    981 - 1050
SIKNLMLRDASTVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP   1051 - 1120
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA            1121 - 1181
//

Text Mined References (53)

PMID Year Title
26320193 2015 S100P interacts with integrin ?7 and increases cancer cell migration and invasion in lung cancer.
26076707 2015 Human ?7 Integrin Gene (ITGA7) Delivered by Adeno-Associated Virus Extends Survival of Severely Affected Dystrophin/Utrophin-Deficient Mice.
26011651 2015 Epigenetic down-regulation of integrin ?7 increases migratory potential and confers poor prognosis in malignant pleural mesothelioma.
24227711 2013 ?6?1 and ?7?1 integrins are required in Schwann cells to sort axons.
24091324 2013 Integrins protect cardiomyocytes from ischemia/reperfusion injury.
23830872 2013 Integrin ?7 binds tissue inhibitor of metalloproteinase 3 to suppress growth of prostate cancer cells.
23800289 2013 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22779914 2012 Biophysical and structural studies of the human calcium- and integrin-binding protein family: understanding their functional similarities and differences.
20651226 2010 Integrin alpha 7 interacts with high temperature requirement A2 (HtrA2) to induce prostate cancer cell death.
More...