Property Summary

NCBI Gene PubMed Count 51
PubMed Score 42.42
PubTator Score 41.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Congenital muscular dystrophy 29 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.300 2.4e-03
astrocytoma 1.900 2.5e-02
Astrocytoma, Pilocytic 1.700 5.9e-06
breast carcinoma -2.000 4.1e-03
colon cancer -2.100 2.6e-04
cystic fibrosis -1.155 8.9e-05
diabetes mellitus -1.100 2.2e-03
ductal carcinoma in situ -3.000 3.9e-04
ependymoma 1.600 1.2e-06
fibroadenoma -2.400 2.4e-02
glioblastoma 1.300 6.9e-04
group 3 medulloblastoma -1.300 1.3e-03
Hydrolethalus syndrome 1.648 3.2e-02
inflammatory breast cancer -1.500 8.2e-04
interstitial cystitis 1.200 1.5e-03
invasive ductal carcinoma -3.600 1.5e-03
oligodendroglioma 1.600 3.5e-03
psoriasis 1.200 2.0e-04

Gene RIF (18)

AA Sequence

MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWL      1 - 70
LVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC     71 - 140
AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSH    141 - 210
YLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDP    211 - 280
DQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLV    281 - 350
PEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGS    351 - 420
PDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGIKSFGYSLSGS    421 - 490
LDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPS    491 - 560
SYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKL    561 - 630
RAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCT    631 - 700
RVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGV    701 - 770
RALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVS    771 - 840
ARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWP    841 - 910
HEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWP    911 - 980
VSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKS    981 - 1050
SIKNLMLRDASTVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP   1051 - 1120
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA            1121 - 1181
//

Text Mined References (53)

PMID Year Title