Property Summary

NCBI Gene PubMed Count 37
PubMed Score 53.24
PubTator Score 34.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Orotic aciduria 18 3.669 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.400 4.3e-06
medulloblastoma, large-cell -1.700 6.8e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma -1.724 1.0e-09
psoriasis -1.300 3.7e-04

Protein-protein Interaction (13)

Gene RIF (19)

AA Sequence

MESPGESGAGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLTRPVWL      1 - 70
QLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSHYILESPGGVSLEGSELMFPD     71 - 140
LVQLICAYCHTRDILLLPLQLPRAIHHAATHKELEAISHLGIEFWSSSLNIKAQRGPAGGPVLPQLKARS    141 - 210
PQELDQGTGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTER    211 - 280
LPPCQLLRRESSVGYRVPAGSGPSLPPMPSLQEVDCGSPSSSEEEGVPGSRGSPATSPHLGRRRPLLRSM    281 - 350
SAAFCSLLAPERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPE    351 - 420
KLLSPKRLEHVLEKSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAFGSHLSLPSPV    421 - 490
ELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFLPLLSLVLAHCDLPELLLEAE    491 - 560
YMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELRRSLSLWEQRRLPATHCFQHLLRV    561 - 630
AYQDPSSGCTSKTLAVPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLV    631 - 700
YRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQP    701 - 770
GEPEAEGSRAAEE                                                             771 - 783
//

Text Mined References (41)

PMID Year Title