Property Summary

NCBI Gene PubMed Count 1
Grant Count 202
R01 Count 135
Funding $14,421,934.92
PubMed Score 309.34

Knowledge Summary

Patent

No data available

Synonym

Accession Q13670
Symbols PMSR6
PMS2L11

Gene

 GO Component (1)

AA Sequence

MEKLSAASGYSDVTDSKAMGPLAVGCLTKCSHAFHLLCLLAMYCNGNKGPEHPNPGKPFTARGFPASATF      1 - 70
QTTPGPQASRGFQNPETLADIPASPQLLTDGHYMTLPVSPDQLPCDDPMAGSGGAPVLRVGHDHGCHQQP     71 - 140
RICNAPLPGPGPYRTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGMD    141 - 210
LIEVSGNGCGVEEENFEGLMMSPFLPATSRRRLGLDWCLITMGKSSRRPPTPTPEGPQSA              211 - 270
//

Text Mined References (1)

PMID Year Title
8586419 1995 Genomic organization of the human PMS2 gene family.