Property Summary

NCBI Gene PubMed Count 1
PubMed Score 339.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
ovarian cancer 8520 0.0 5.0
Disease Target Count Z-score Confidence
Lynch syndrome 35 7.723 3.9

Synonym

Accession Q13670
Symbols PMSR6
PMS2L11

Gene

 GO Component (1)

 GWAS Trait (1)

AA Sequence

MEKLSAASGYSDVTDSKAMGPLAVGCLTKCSHAFHLLCLLAMYCNGNKGPEHPNPGKPFTARGFPASATF      1 - 70
QTTPGPQASRGFQNPETLADIPASPQLLTDGHYMTLPVSPDQLPCDDPMAGSGGAPVLRVGHDHGCHQQP     71 - 140
RICNAPLPGPGPYRTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGMD    141 - 210
LIEVSGNGCGVEEENFEGLMMSPFLPATSRRRLGLDWCLITMGKSSRRPPTPTPEGPQSA              211 - 270
//

Text Mined References (1)

PMID Year Title