Property Summary

NCBI Gene PubMed Count 121
Grant Count 85
R01 Count 60
Funding $7,240,117.92
PubMed Score 86.71
PubTator Score 138.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q13651 A8K6I0 B0YJ27 IL-10 receptor subunit alpha
Symbols CD210
IL10R
CD210a
CDW210A
HIL-10R
IL-10R1

Gene

PDB

1J7V   1LQS   1Y6K   1Y6M   1Y6N   5IXI  

Gene RIF (102)

PMID Text
26962683 results suggest that IL10-mediated inhibition of autophagy is facilitated by the cross talk between STAT3, AKT, and mTOR; in other words, the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26631117 IL-10Ralpha expression is post-transcriptionally regulated by miR-15a, miR-185, and miR-211 in melanoma
25733167 High IL10RA expression is associated with diffuse large B-cell lymphoma.
25472783 Data suggest that, compared with monocytes and macrophages, myeloid dendritic cells partially escape from IL-10's inhibitory mechanisms by downregulating IL-10R1.
25373860 genetic association study in cohort of infants/children: Data suggest perianal fistulas are exhibited in patients with very early-onset inflammatory bowel disease with IL10 receptor mutations (IL10RA/B); prognosis and response to treatment are poor.
25326368 We also observed that BM-MSCs upregulated IL-10 secretion as well as the expression of its receptor CD210 on T cells, thus creating a loop favoring the expansion of IL-10-producing T cells
24785691 Inflammatory bowel disease (IBD) in infancy is phenotypically and genetically different disease entity from adult-onset or older child-onset IBD. It has a strong association with IL-10 receptor gene.
24689510 IL10R1 loss-of-function A536/S138G polymorphism may contribute to recurrent pregnancy loss pathogenesis
24581234 No evidence for an involvement of autoantibodies against IL-10 or IL-10R in the pathogenesis of inflammatory bowel disease could be established.
24566517 SNP3 polymorphism is associated with myocardial infarction; may generate some conformational rearrangements of the IL-10R1 receptor domain which affects IL-10 complex binding and alters its downstream signal
More...

AA Sequence

MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWN      1 - 70
SISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFIL     71 - 140
GKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVA    141 - 210
SRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIF    211 - 280
ISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGN    281 - 350
REPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS    351 - 420
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPP    421 - 490
ALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGS    491 - 560
FNSDLVTLPLISSLQSSE                                                        561 - 578
//

Text Mined References (124)

PMID Year Title
26962683 2016 IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26631117 2015 IL-10R? expression is post-transcriptionally regulated by miR-15a, miR-185, and miR-211 in melanoma.
25733167 2015 IL10 receptor is a novel therapeutic target in DLBCLs.
25472783 Interleukin-10 receptor-1 expression in monocyte-derived antigen-presenting cell populations: dendritic cells partially escape from IL-10's inhibitory mechanisms.
25373860 2015 Clinical features of interleukin 10 receptor gene mutations in children with very early-onset inflammatory bowel disease.
25326368 2015 Bone Marrow Mesenchymal Stromal Cells Induce Proliferative, Cytokinic and Molecular Changes During the T Cell Response: The Importance of the IL-10/CD210 Axis.
24785691 2014 Very early-onset inflammatory bowel disease (IBD) in infancy is a different disease entity from adult-onset IBD; one form of interleukin-10 receptor mutations.
24689510 2014 Association of the IL-10 receptor A536G (S138G) loss-of-function variant with recurrent miscarriage.
24581234 2014 Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.
24566517 2014 IL-10R1 (Ser138Gly) functional polymorphism is associated with acute myocardial infarction in Tunisian patients.
More...