Property Summary

NCBI Gene PubMed Count 131
PubMed Score 94.93
PubTator Score 138.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
ulcerative colitis 2.200 2.8e-06
adrenocortical carcinoma -1.632 2.0e-03
astrocytic glioma 1.100 3.1e-02
chronic kidney disease 1.100 1.8e-02
Chronic Lymphocytic Leukemia 1.590 8.1e-04
cutaneous lupus erythematosus 1.800 1.6e-03
glioblastoma 1.900 1.1e-02
group 4 medulloblastoma -1.100 8.1e-04
interstitial cystitis 2.100 3.9e-04
invasive ductal carcinoma 2.047 9.3e-04
lung cancer -2.300 4.9e-05
lung carcinoma -2.000 3.1e-21
mucosa-associated lymphoid tissue lympho... 2.236 4.2e-02
Multiple myeloma -1.098 2.6e-02
non-small cell lung cancer -1.486 4.5e-12
osteosarcoma -1.333 4.3e-02
ovarian cancer -2.100 1.7e-06
periodontitis 1.400 1.1e-29
primary Sjogren syndrome 1.700 2.7e-03
subependymal giant cell astrocytoma 2.258 3.7e-02
Waldenstrons macroglobulinemia 1.821 3.6e-03

Protein-protein Interaction (1)

Gene RIF (111)

AA Sequence

MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWN      1 - 70
SISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFIL     71 - 140
GKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVA    141 - 210
SRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIF    211 - 280
ISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGN    281 - 350
REPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS    351 - 420
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPP    421 - 490
ALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGS    491 - 560
FNSDLVTLPLISSLQSSE                                                        561 - 578
//

Text Mined References (134)

PMID Year Title