Property Summary

NCBI Gene PubMed Count 29
PubMed Score 5.67
PubTator Score 23.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy -1.165 8.0e-05
autosomal dominant Emery-Dreifuss muscul... -1.098 1.3e-02
Duchenne muscular dystrophy -1.241 4.8e-07
juvenile dermatomyositis -1.157 2.4e-09
osteosarcoma 1.204 2.7e-04
psoriasis 1.700 4.5e-05

Gene RIF (14)

AA Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR      1 - 70
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS     71 - 140
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV    141 - 210
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP    211 - 280
//

Text Mined References (35)

PMID Year Title