Property Summary

NCBI Gene PubMed Count 26
Grant Count 6
R01 Count 5
Funding $549,786.77
PubMed Score 5.66
PubTator Score 23.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.204 0.000
Duchenne muscular dystrophy -1.241 0.000
autosomal dominant Emery-Dreifuss muscul... -1.098 0.013
juvenile dermatomyositis -1.157 0.000
acute quadriplegic myopathy -1.165 0.000

Gene RIF (14)

PMID Text
25659096 the present study established a link between Ang and FHL3 proteins and identifies a new pathway for regulating astrocytoma progression.
24998228 PCBP2 could bind to FHL3 mRNA 3'UTR-A and inhibited the expression of FHL3 in T98G glioms cells
24690879 These findings suggest that functional interactions between FHL3 and MT-1X may provide some clues to the mechanisms of FHL3-regulated cell proliferation.
23616667 FHL3 enhances Tax1-mediated activation of the Human T-cell leukemia virus type 1 long terminal repeat (LTR) without affecting basal activity and regulates NF-kappaB activation by Tax1 in a cell-specific manner.
22633874 findings suggest that the interaction between Ang and FHL3 may provide some clues to the mechanisms of Ang-regulated cell growth and apoptosis
22362714 FHL3 suppressed anchorage-dependent and -independent growth of human breast cancer cells.
22219185 FHL3 does not bind to HIF-1alpha or p300, indicating that it regulates transactivation by a novel molecular mechanism.
20586194 the second zinc finger motif in LIM4 was responsible for the auto-activation of FHL3.
19139564 Human four-and-a-half LIM family members suppress tumor cell growth through a TGF-beta-like signaling pathway.
18187620 Knockdown of four and a half LIM domains 3 (FHL3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR      1 - 70
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS     71 - 140
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV    141 - 210
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP    211 - 280
//

Text Mined References (32)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25659096 2015 Angiogenin promotes U87MG cell proliferation by activating NF-?B signaling pathway and downregulating its binding partner FHL3.
25416956 2014 A proteome-scale map of the human interactome network.
24998228 2014 Ribotrap analysis of proteins associated with FHL3 3'untranslated region in glioma cells.
24690879 2014 Identification and characterization of MT-1X as a novel FHL3-binding partner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23616667 2013 The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22633874 2012 Identification and characterization of FHL3 as a novel angiogenin-binding partner.
22362714 2011 Downregulation and antiproliferative role of FHL3 in breast cancer.
More...