Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.66
PubTator Score 23.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.42746617764644E-9
Duchenne muscular dystrophy 602 4.79509411746068E-7
psoriasis 6685 4.49725706411424E-5
acute quadriplegic myopathy 1157 7.97888848920446E-5
osteosarcoma 7933 2.67570941467291E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0130056774377289
Disease Target Count Z-score Confidence
Brain glioma 10 3.773 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.204 0.000
Duchenne muscular dystrophy -1.241 0.000
autosomal dominant Emery-Dreifuss muscul... -1.098 0.013
juvenile dermatomyositis -1.157 0.000
acute quadriplegic myopathy -1.165 0.000

Synonym

Accession Q13643 D3DPT6 Q6I9T0 Q9BVA2 FHL-3
Symbols SLIM2

Gene

PDB

1WYH   2CUQ   2EHE  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (14)

PMID Text
25659096 the present study established a link between Ang and FHL3 proteins and identifies a new pathway for regulating astrocytoma progression.
24998228 PCBP2 could bind to FHL3 mRNA 3'UTR-A and inhibited the expression of FHL3 in T98G glioms cells
24690879 These findings suggest that functional interactions between FHL3 and MT-1X may provide some clues to the mechanisms of FHL3-regulated cell proliferation.
23616667 FHL3 enhances Tax1-mediated activation of the Human T-cell leukemia virus type 1 long terminal repeat (LTR) without affecting basal activity and regulates NF-kappaB activation by Tax1 in a cell-specific manner.
22633874 findings suggest that the interaction between Ang and FHL3 may provide some clues to the mechanisms of Ang-regulated cell growth and apoptosis
22362714 FHL3 suppressed anchorage-dependent and -independent growth of human breast cancer cells.
22219185 FHL3 does not bind to HIF-1alpha or p300, indicating that it regulates transactivation by a novel molecular mechanism.
20586194 the second zinc finger motif in LIM4 was responsible for the auto-activation of FHL3.
19139564 Human four-and-a-half LIM family members suppress tumor cell growth through a TGF-beta-like signaling pathway.
18187620 Knockdown of four and a half LIM domains 3 (FHL3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR      1 - 70
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS     71 - 140
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV    141 - 210
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP    211 - 280
//

Text Mined References (32)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25659096 2015 Angiogenin promotes U87MG cell proliferation by activating NF-?B signaling pathway and downregulating its binding partner FHL3.
25416956 2014 A proteome-scale map of the human interactome network.
24998228 2014 Ribotrap analysis of proteins associated with FHL3 3'untranslated region in glioma cells.
24690879 2014 Identification and characterization of MT-1X as a novel FHL3-binding partner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23616667 2013 The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22633874 2012 Identification and characterization of FHL3 as a novel angiogenin-binding partner.
22362714 2011 Downregulation and antiproliferative role of FHL3 in breast cancer.
More...